• Gene id: 1936

Gene Summary

• Gene Symbol: EEF1D   Gene   UCSC   Ensembl
• Aliases: EF-1D, EF1D, FP1047
• Gene name: eukaryotic translation elongation factor 1 delta
• Alternate names: elongation factor 1-delta, EF-1-delta, antigen NY-CO-4, eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein),
• Gene location: 8q24.3 (143597674: 143579693)     Exons: 10     NC_000008.11
• Gene summary(Entrez): This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 i
• OMIM: 130592

Protein Summary

• Protein general information: P29692  
  • Name: Elongation factor 1 delta (EF 1 delta) (Antigen NY CO 4)
  • Length: 281  
  • Mass: 31122
  • Tissue specificity: Isoform 2 is specifically expressed in brain, cerebellum and testis.
• Sequence:

  MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGASSGTSG
  DHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEPPAKKPATPAE
  DDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDG
  LVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI

• Structural information:
  • Interpro: IPR036219  IPR018940  IPR014038  IPR014717  IPR001326  
  • Prosite: PS00824 PS00825
  • CDD: cd00292
  • PDB: 2MVM 2MVN 2N51 5JPO
  • PDBsum: 2MVM 2MVN 2N51 5JPO
  • STRING: ENSP00000410059
• Other Databases: GeneCards:  EEF1D  Malacards:  EEF1D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006414	translational elongation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0005853	eukaryotic translation elongation factor 1 complex	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006414	translational elongation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0006414	translational elongation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0005853	eukaryotic translation elongation factor 1 complex	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq