• Gene id: 192669

Gene Summary

• Gene Symbol: AGO3   Gene   UCSC   Ensembl
• Aliases: EIF2C3
• Gene name: argonaute RISC catalytic component 3
• Alternate names: protein argonaute-3, argonaute 3, RISC catalytic component, eukaryotic translation initiation factor 2C, 3, hAgo3,
• Gene location: 1p34.3 (35925682: 36072499)     Exons: 25     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This
• OMIM: 607355

Protein Summary

• Protein general information: Q9H9G7  
  • Name: Protein argonaute 3 (Argonaute3) (hAgo3) (EC 3.1.26.n2) (Argonaute RISC catalytic component 3) (Eukaryotic translation initiation factor 2C 3) (eIF 2C 3) (eIF2C 3)
  • Length: 860  
  • Mass: 97360
• Sequence:

  MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFK
  VTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLE
  LDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAF
  YKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE
  NGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPD
  RQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVEIK
  MWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPG
  KTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT
  HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEG
  QFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFY
  LCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDS
  AEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA

• Structural information:
  • Protein Domains: (236..34-)
    (/note="PAZ-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03032-)
    (518..81-)
    (/note="Piwi-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03032"-)
  • Interpro: IPR028603  IPR014811  IPR032472  IPR032473  IPR032474   IPR003100  IPR036085  IPR003165  IPR012337  IPR036397  
  • Prosite: PS50821 PS50822
  • PDB: 5VM9
  • PDBsum: 5VM9
  • DIP: 54486
  • STRING: ENSP00000362287
• Other Databases: GeneCards:  AGO3  Malacards:  AGO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090624	endoribonuclease activity, cleaving miRNA-paired mRNA	IMP	molecular function
GO:0004521	endoribonuclease activity	IMP	molecular function
GO:0072091	regulation of stem cell proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0072091	regulation of stem cell proliferation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0010629	negative regulation of gene expression	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010628	positive regulation of gene expression	TAS	biological process
GO:0035194	post-transcriptional gene silencing by RNA	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:0016442	RISC complex	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IMP	biological process
GO:0010501	RNA secondary structure unwinding	IMP	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0035279	mRNA cleavage involved in gene silencing by miRNA	IDA	NOT|biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0090625	mRNA cleavage involved in gene silencing by siRNA	IDA	NOT|biological process
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0035198	miRNA binding	IEA	molecular function
GO:0035278	miRNA mediated inhibition of translation	IEA	biological process
GO:0016442	RISC complex	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0035279	mRNA cleavage involved in gene silencing by miRNA	IEA	biological process
GO:0035278	miRNA mediated inhibition of translation	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881