• Gene id: 192111

Gene Summary

• Gene Symbol: PGAM5   Gene   UCSC   Ensembl
• Aliases: BXLBV68
• Gene name: PGAM family member 5, mitochondrial serine/threonine protein phosphatase
• Alternate names: serine/threonine-protein phosphatase PGAM5, mitochondrial, Bcl-XL-binding protein v68, PGAM family member 5, serine/threonine protein phosphatase, mitochondrial, phosphoglycerate mutase family member 5,
• Gene location: 12q24.33 (132710841: 132722733)     Exons: 7     NC_000012.12
• OMIM: 615854

Protein Summary

• Protein general information: Q96HS1  
  • Name: Serine/threonine protein phosphatase PGAM5, mitochondrial (EC 3.1.3.16) (Bcl XL binding protein v68) (Phosphoglycerate mutase family member 5)
  • Length: 289  
  • Mass: 32004
• Sequence:

  MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRK
  RNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSM
  TRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYE
  IFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

• Structural information:
  • Interpro: IPR013078  IPR029033  
  • CDD: cd07067
  • PDB: 3MXO 3O0T 5MUF 6CNI 6CNL
  • PDBsum: 3MXO 3O0T 5MUF 6CNI 6CNL
  • DIP: 50735
  • STRING: ENSP00000438465
• Other Databases: GeneCards:  PGAM5  Malacards:  PGAM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0012501	programmed cell death	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070266	necroptotic process	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0070266	necroptotic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04217	Necroptosis
hsa04668	TNF signaling pathway
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881