• Gene id: 1915

Gene Summary

• Gene Symbol: EEF1A1   Gene   UCSC   Ensembl
• Aliases: CCS-3, CCS3, EE1A1, EEF-1, EEF1A, EF-Tu, EF1A, GRAF-1EF, LENG7, PTI1, eEF1A-1
• Gene name: eukaryotic translation elongation factor 1 alpha 1
• Alternate names: elongation factor 1-alpha 1, CTCL tumor antigen, EF-1-alpha-1, EF1a-like protein, cervical cancer suppressor 3, elongation factor 1 alpha subunit, elongation factor Tu, epididymis secretory sperm binding protein, eukaryotic elongation factor 1 A-1, eukaryotic tran,
• Gene location: 6q13 (73521031: 73515749)     Exons: 8     NC_000006.12
• Gene summary(Entrez): This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and panc
• OMIM: 130590

Protein Summary

• Protein general information: P68104  
  • Name: Elongation factor 1 alpha 1 (EF 1 alpha 1) (Elongation factor Tu) (EF Tu) (Eukaryotic elongation factor 1 A 1) (eEF1A 1) (Leukocyte receptor cluster member 7)
  • Length: 462  
  • Mass: 50141
  • Tissue specificity: Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
• Sequence:

  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDI
  SLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIV
  GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASG
  TTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
  EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAEL
  KEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
  VTKSAQKAQKAK

• Structural information:
  • Protein Domains: (5..24-)
    (/note="tr-type-G")
  • Interpro: IPR004161  IPR031157  IPR027417  IPR000795  IPR009000   IPR009001  IPR004539  IPR004160  
  • Prosite: PS00301 PS51722
  • PDB: 1SYW 3C5J
  • PDBsum: 1SYW 3C5J
  • DIP: 31277
  • STRING: ENSP00000339063
• Other Databases: GeneCards:  EEF1A1  Malacards:  EEF1A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098574	cytoplasmic side of lysosomal membrane	NAS	cellular component
GO:1904714	regulation of chaperone-mediated autophagy	NAS	biological process
GO:0006414	translational elongation	IBA	biological process
GO:0006412	translation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0003746	translation elongation factor activity	IBA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1900022	regulation of D-erythro-sphingosine kinase activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0003746	translation elongation factor activity	TAS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006414	translational elongation	IEA	biological process
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0006414	translational elongation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000049	tRNA binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0006414	translational elongation	TAS	biological process
GO:0005525	GTP binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005853	eukaryotic translation elongation factor 1 complex	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05140	Leishmaniasis
hsa05134	Legionellosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)