• Gene id: 191

Gene Summary

• Gene Symbol: AHCY   Gene   UCSC   Ensembl
• Aliases: SAHH, adoHcyase
• Gene name: adenosylhomocysteinase
• Alternate names: adenosylhomocysteinase, S-adenosyl-L-homocysteine hydrolase, S-adenosylhomocysteine hydrolase, epididymis secretory sperm binding protein,
• Gene location: 20q11.22 (34311975: 34235011)     Exons: 17     NC_000020.11
• Gene summary(Entrez): S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. It catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocystei
• OMIM: 180960

Protein Summary

• Protein general information: P23526  
  • Name: Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S adenosyl L homocysteine hydrolase)
  • Length: 432  
  • Mass: 47716
• Sequence:

  MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQ
  WSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGI
  RGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVG
  KGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
  HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTH
  PDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY

• Structural information:
  • Interpro: IPR042172  IPR000043  IPR015878  IPR036291  IPR020082  
  • Prosite: PS00738 PS00739
  • CDD: cd00401
  • PDB: 1A7A 1LI4 3NJ4 4PFJ 4PGF 4YVF 5W49 5W4B
  • PDBsum: 1A7A 1LI4 3NJ4 4PFJ 4PGF 4YVF 5W49 5W4B
  • DIP: 50557
  • STRING: ENSP00000217426
• Other Databases: GeneCards:  AHCY  Malacards:  AHCY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004013	adenosylhomocysteinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0033353	S-adenosylmethionine cycle	IBA	biological process
GO:0004013	adenosylhomocysteinase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004013	adenosylhomocysteinase activity	IEA	molecular function
GO:0000096	sulfur amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0032259	methylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0042745	circadian sleep/wake cycle	IEA	biological process
GO:0030554	adenyl nucleotide binding	IEA	molecular function
GO:0007584	response to nutrient	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001666	response to hypoxia	IEA	biological process
GO:0051287	NAD binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0019510	S-adenosylhomocysteine catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004013	adenosylhomocysteinase activity	IEA	molecular function
GO:0002439	chronic inflammatory response to antigenic stimulus	IEA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004013	adenosylhomocysteinase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Hypermethioninemia	KEGG:H00184
Hypermethioninemia	KEGG:H00184
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq