• Gene id: 1903

Gene Summary

• Gene Symbol: S1PR3   Gene   UCSC   Ensembl
• Aliases: EDG-3, EDG3, LPB3, S1P3
• Gene name: sphingosine-1-phosphate receptor 3
• Alternate names: sphingosine 1-phosphate receptor 3, G protein-coupled receptor, endothelial differentiation gene-3, S1P receptor 3, S1P receptor EDG3, S1P receptor Edg-3, endothelial differentiation G-protein coupled receptor 3, endothelial differentiation, sphingolipid G-prot,
• Gene location: 9q22.1 (88991467: 89005154)     Exons: 2     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular e
• OMIM: 616696

Protein Summary

• Protein general information: Q99500  
  • Name: Sphingosine 1 phosphate receptor 3 (S1P receptor 3) (S1P3) (Endothelial differentiation G protein coupled receptor 3) (Sphingosine 1 phosphate receptor Edg 3) (S1P receptor Edg 3)
  • Length: 378  
  • Mass: 42250
  • Tissue specificity: Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
• Sequence:

  MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMY
  FFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANK
  RHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSS
  SRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
  ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGI
  FCN

• Structural information:
  • Interpro: IPR004062  IPR000276  IPR017452  IPR004061  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000365006
• Other Databases: GeneCards:  S1PR3  Malacards:  S1PR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0008289	lipid binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0032651	regulation of interleukin-1 beta production	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0001816	cytokine production	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005178	integrin binding	IPI	molecular function
GO:1903141	negative regulation of establishment of endothelial barrier	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04071	Sphingolipid signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R