• Gene id: 1902

Gene Summary

• Gene Symbol: LPAR1   Gene   UCSC   Ensembl
• Aliases: EDG2, GPR26, Gpcr26, LPA1, Mrec1.3, VZG1, edg-2, rec.1.3, vzg-1
• Gene name: lysophosphatidic acid receptor 1
• Alternate names: lysophosphatidic acid receptor 1, LPA receptor 1, LPA-1, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2, lysophosphatidic acid receptor Edg-2, ventricular zone gene 1,
• Gene location: 9q31.3 (111038997: 110873251)     Exons: 15     NC_000009.12
• Gene summary(Entrez): The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors
• OMIM: 605592

Protein Summary

• Protein general information: Q92633  
  • Name: Lysophosphatidic acid receptor 1 (LPA receptor 1) (LPA 1) (Lysophosphatidic acid receptor Edg 2)
  • Length: 364  
  • Mass: 41109
  • Tissue specificity: Expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testes, spleen, skeletal muscle, and kidney. Little or no expression in liver, lung, thymus, or peripheral blood leuko
• Sequence:

  MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMVAIY
  VNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITV
  FRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLY
  AHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
  EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR004065  IPR002277  
  • Prosite: PS00237 PS50262
  • CDD: cd15344
  • PDB: 4Z34 4Z35 4Z36
  • PDBsum: 4Z34 4Z35 4Z36
  • STRING: ENSP00000363553
• Other Databases: GeneCards:  LPAR1  Malacards:  LPAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0070915	lysophosphatidic acid receptor activity	IBA	molecular function
GO:0022008	neurogenesis	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0035727	lysophosphatidic acid binding	IDA	molecular function
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0070915	lysophosphatidic acid receptor activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030139	endocytic vesicle	IDA	colocalizes with
GO:0009986	cell surface	IDA	cellular component
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0008360	regulation of cell shape	ISS	biological process
GO:0070915	lysophosphatidic acid receptor activity	IMP	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070915	lysophosphatidic acid receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0070915	lysophosphatidic acid receptor activity	IEA	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0007202	activation of phospholipase C activity	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:1904566	cellular response to 1-oleoyl-sn-glycerol 3-phosphate	IEA	biological process
GO:0071673	positive regulation of smooth muscle cell chemotaxis	IEA	biological process
GO:0071453	cellular response to oxygen levels	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042552	myelination	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0032060	bleb assembly	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IEA	biological process
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0022038	corpus callosum development	IEA	biological process
GO:0021554	optic nerve development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0070915	lysophosphatidic acid receptor activity	IBA	molecular function
GO:0022008	neurogenesis	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0035727	lysophosphatidic acid binding	IDA	molecular function
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0070915	lysophosphatidic acid receptor activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030139	endocytic vesicle	IDA	colocalizes with
GO:0009986	cell surface	IDA	cellular component
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0008360	regulation of cell shape	ISS	biological process
GO:0070915	lysophosphatidic acid receptor activity	IMP	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070915	lysophosphatidic acid receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0070915	lysophosphatidic acid receptor activity	IEA	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0007202	activation of phospholipase C activity	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:1904566	cellular response to 1-oleoyl-sn-glycerol 3-phosphate	IEA	biological process
GO:0071673	positive regulation of smooth muscle cell chemotaxis	IEA	biological process
GO:0071453	cellular response to oxygen levels	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042552	myelination	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0032060	bleb assembly	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IEA	biological process
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0022038	corpus callosum development	IEA	biological process
GO:0021554	optic nerve development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04151	PI3K-Akt signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05130	Pathogenic Escherichia coli infection
hsa04072	Phospholipase D signaling pathway
hsa04540	Gap junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)