• Gene id: 1901

Gene Summary

• Gene Symbol: S1PR1   Gene   UCSC   Ensembl
• Aliases: CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1
• Gene name: sphingosine-1-phosphate receptor 1
• Alternate names: sphingosine 1-phosphate receptor 1, S1P receptor 1, S1P receptor Edg-1, endothelial differentiation G-protein coupled receptor 1, endothelial differentiation, sphingolipid G-protein-coupled receptor, 1, sphingosine 1-phosphate receptor EDG1, sphingosine 1-phosp,
• Gene location: 1p21.2 (159397464: 159440966)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the
• OMIM: 601974

Protein Summary

• Protein general information: P21453  
  • Name: Sphingosine 1 phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G protein coupled receptor 1) (Sphingosine 1 phosphate receptor Edg 1) (S1P receptor Edg 1) (CD antigen CD363)
  • Length: 382  
  • Mass: 42811
  • Tissue specificity: Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
• Sequence:

  MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKK
  FHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMK
  LHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIY
  SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
  VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSS
  GNVNSSS

• Structural information:
  • Interpro: IPR000987  IPR000276  IPR017452  IPR004061  
  • Prosite: PS00237 PS50262
  • PDB: 3V2W 3V2Y
  • PDBsum: 3V2W 3V2Y
  • DIP: 60427
  • STRING: ENSP00000305416
• Other Databases: GeneCards:  S1PR1  Malacards:  S1PR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0001525	angiogenesis	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0038036	sphingosine-1-phosphate receptor activity	IBA	molecular function
GO:0038036	sphingosine-1-phosphate receptor activity	IDA	molecular function
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IDA	biological process
GO:0072678	T cell migration	ISS	biological process
GO:0030032	lamellipodium assembly	ISS	biological process
GO:0016477	cell migration	ISS	biological process
GO:0003245	cardiac muscle tissue growth involved in heart morphogenesis	ISS	biological process
GO:0001955	blood vessel maturation	ISS	biological process
GO:0061384	heart trabecula morphogenesis	ISS	biological process
GO:0045124	regulation of bone resorption	ISS	biological process
GO:0031532	actin cytoskeleton reorganization	ISS	biological process
GO:0030500	regulation of bone mineralization	ISS	biological process
GO:0006935	chemotaxis	ISS	biological process
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019226	transmission of nerve impulse	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0050927	positive regulation of positive chemotaxis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001955	blood vessel maturation	IEA	biological process
GO:0003245	cardiac muscle tissue growth involved in heart morphogenesis	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0030032	lamellipodium assembly	IEA	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0072678	T cell migration	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045446	endothelial cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046625	sphingolipid binding	IEA	molecular function
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IEA	biological process
GO:0051497	negative regulation of stress fiber assembly	IEA	biological process
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0045124	regulation of bone resorption	IEA	biological process
GO:0061384	heart trabecula morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0001664	G protein-coupled receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04071	Sphingolipid signaling pathway
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)