• Gene id: 1893

Gene Summary

• Gene Symbol: ECM1   Gene   UCSC   Ensembl
• Aliases: URBWD
• Gene name: extracellular matrix protein 1
• Alternate names: extracellular matrix protein 1, secretory component p85, testicular tissue protein Li 61,
• Gene location: 1q21.2 (150508010: 150513788)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeosta
• OMIM: 602201

Protein Summary

• Protein general information: Q16610  
  • Name: Extracellular matrix protein 1 (Secretory component p85)
  • Length: 540  
  • Mass: 60,674
• Sequence:

  MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQV
  QPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQH
  CQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRS
  HTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFP
  PGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYA
  VKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCC
  DLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGS
  TGGTNISSTSEPKEE

• Structural information:
  • Interpro: IPR008605  IPR020858  
  • STRING: ENSP00000358045
• Other Databases: GeneCards:  ECM1  Malacards:  ECM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0002828	regulation of type 2 immune response	IEA	biological process
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005134	interleukin-2 receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030502	negative regulation of bone mineralization	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043236	laminin binding	IPI	molecular function
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000404	regulation of T cell migration	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0002828	regulation of type 2 immune response	IEA	biological process
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005134	interleukin-2 receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0030502	negative regulation of bone mineralization	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043236	laminin binding	IPI	molecular function
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000404	regulation of T cell migration	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	NAS	cellular component
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030502	negative regulation of bone mineralization	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043236	laminin binding	IPI	molecular function
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Ulcerative colitis	GAD: 19861958
Inflammatory bowel disease	GAD: 20014019
Male factor infertility	MIK: 24259048
Azoospermia	MIK: 24259048
Lipoid proteinosis	KEGG: H00883
Urbach-Wiethe disease	OMIM: 602201
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 24259048
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24259048	Azoospermia			199 seminal plasma samples from men with normal spermatogenesis and azoospermia	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq