• Gene id: 1870

Gene Summary

• Gene Symbol: E2F2   Gene   UCSC   Ensembl
• Aliases: E2F-2
• Gene name: E2F transcription factor 2
• Alternate names: transcription factor E2F2,
• Gene location: 1p36.12 (23531249: 23505695)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DN
• OMIM: 600426

Protein Summary

• Protein general information: Q14209  
  • Name: Transcription factor E2F2 (E2F 2)
  • Length: 437  
  • Mass: 47506
  • Tissue specificity: Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
• Sequence:

  MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVV
  RCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESED
  GVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALD
  QLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
  YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLL
  ELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN

• Structural information:
  • Interpro: IPR015633  IPR037241  IPR032198  IPR003316  IPR036388   IPR036390  
  • CDD: cd14660
  • PDB: 1N4M
  • PDBsum: 1N4M
  • DIP: 258
  • STRING: ENSP00000355249
• Other Databases: GeneCards:  E2F2  Malacards:  E2F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	contributes to
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	contributes to
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IEA	biological process
GO:1990086	lens fiber cell apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:1903671	negative regulation of sprouting angiogenesis	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa05224	Breast cancer
hsa05160	Hepatitis C
hsa04110	Cell cycle
hsa05222	Small cell lung cancer
hsa01522	Endocrine resistance
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05214	Glioma
hsa05212	Pancreatic cancer
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa05219	Bladder cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881