Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 1857
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol DVL3   Gene   UCSC   Ensembl
Aliases DRS3
Gene name dishevelled segment polarity protein 3
Alternate names segment polarity protein dishevelled homolog DVL-3, dishevelled 3 (homologous to Drosophila dsh), dishevelled, dsh homolog 3,
Gene location 3q27.1 (184155310: 184173613)     Exons: 16     NC_000003.12
Gene summary(Entrez) This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation. [provided by RefSeq, Jul 2008]
OMIM 608550

Protein Summary
Protein general information Q92997  

Name: Segment polarity protein dishevelled homolog DVL 3 (Dishevelled 3) (DSH homolog 3)

Length: 716  Mass: 78055

Sequence MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVV
SWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRD
GPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQK
VSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAY
GMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDW
LYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLP
HPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAA
MGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Structural information
Protein Domains
 (1..8-)
(/note="DIX-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00069-)
(249..32-)
(/note="PDZ-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
(422..49-)
(/note="DEP-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00066"-)
Interpro:  IPR000591  IPR024580  IPR008339  IPR003351  IPR001158  
IPR038207  IPR015506  IPR008342  IPR001478  IPR036034  IPR029071  IPR036388  IPR036390  
Prosite:   PS50186 PS50841 PS50106

DIP:  
34509
MINT:  
STRING:   ENSP00000316054
Other Databases GeneCards:  DVL3  Malacards:  DVL3

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005109 frizzled binding
 TAS molecular function
GO:0150012 positive regulation of ne
uron projection arborizat
ion
 ISS biological process
GO:0035567 non-canonical Wnt signali
ng pathway
 TAS biological process
GO:0060070 canonical Wnt signaling p
athway
 TAS biological process
GO:0008013 beta-catenin binding
 IDA molecular function
GO:0005829 cytosol
 IDA cellular component
GO:1903827 regulation of cellular pr
otein localization
 IDA biological process
GO:0043547 positive regulation of GT
Pase activity
 IDA biological process
GO:0000790 nuclear chromatin
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048365 Rac GTPase binding
 IPI molecular function
GO:0050821 protein stabilization
 IGI biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 NAS biological process
GO:0060070 canonical Wnt signaling p
athway
 IGI biological process
GO:0005829 cytosol
 IBA cellular component
GO:0090179 planar cell polarity path
way involved in neural tu
be closure
 IBA biological process
GO:0060070 canonical Wnt signaling p
athway
 IBA biological process
GO:0005109 frizzled binding
 IBA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0002020 protease binding
 IPI molecular function
GO:0016055 Wnt signaling pathway
 IEA biological process
GO:0035556 intracellular signal tran
sduction
 IEA biological process
GO:0016055 Wnt signaling pathway
 IEA biological process
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0090090 negative regulation of ca
nonical Wnt signaling pat
hway
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:1904886 beta-catenin destruction
complex disassembly
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0150012 positive regulation of ne
uron projection arborizat
ion
 IEA biological process
GO:0005102 signaling receptor bindin
g
 IEA molecular function
GO:0042493 response to drug
 IEA biological process
GO:0008013 beta-catenin binding
 IDA molecular function
GO:0005102 signaling receptor bindin
g
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0060070 canonical Wnt signaling p
athway
 IDA biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 IDA biological process
GO:0035567 non-canonical Wnt signali
ng pathway
 IMP biological process
GO:0038031 non-canonical Wnt signali
ng pathway via JNK cascad
e
 ISS biological process
GO:0001934 positive regulation of pr
otein phosphorylation
 IMP biological process
GO:0043507 positive regulation of JU
N kinase activity
 IMP biological process
GO:0060070 canonical Wnt signaling p
athway
 IMP biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005109 frizzled binding
 IPI molecular function
GO:0005109 frizzled binding
 IPI molecular function
GO:0005109 frizzled binding
 IPI molecular function
GO:0005109 frizzled binding
 IPI molecular function
GO:0005109 frizzled binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05010Alzheimer disease
hsa05165Human papillomavirus infection
hsa04310Wnt signaling pathway
hsa04150mTOR signaling pathway
hsa04390Hippo signaling pathway
hsa05225Hepatocellular carcinoma
hsa04934Cushing syndrome
hsa05226Gastric cancer
hsa04550Signaling pathways regulating pluripotency of stem cells
hsa05224Breast cancer
hsa04916Melanogenesis
hsa05217Basal cell carcinoma
hsa04330Notch signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Robinow syndrome KEGG:H00485
Robinow syndrome KEGG:H00485
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract