• Gene id: 1856

Gene Summary

• Gene Symbol: DVL2   Gene   UCSC   Ensembl
• Gene name: dishevelled segment polarity protein 2
• Alternate names: segment polarity protein dishevelled homolog DVL-2, dishevelled 2 (homologous to Drosophila dsh), dishevelled, dsh homolog 2,
• Gene location: 17p13.1 (7234543: 7225340)     Exons: 16     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation t
• OMIM: 602151

Protein Summary

• Protein general information: O14641  
  • Name: Segment polarity protein dishevelled homolog DVL 2 (Dishevelled 2) (DSH homolog 2)
  • Length: 736  
  • Mass: 78948
• Sequence:

  MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDN
  ARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE
  TETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTE
  QSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
  KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPID
  PAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIP
  NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDND
  GSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
  AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMAL
  PYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM

• Structural information:
  • Protein Domains: (11..9-)
    (/note="DIX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00069-)
    (267..33-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (433..50-)
    (/note="DEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066"-)
  • Interpro: IPR000591  IPR024580  IPR008339  IPR003351  IPR001158   IPR038207  IPR015506  IPR008341  IPR001478  IPR036034  IPR029071  IPR036388  IPR036390  
  • Prosite: PS50186 PS50841 PS50106
  • PDB: 2REY 3CBX 3CBY 3CBZ 3CC0 4WIP 5LNP 5SUY 5SUZ 6IW3 6JCK
  • PDBsum: 2REY 3CBX 3CBY 3CBZ 3CC0 4WIP 5LNP 5SUY 5SUZ 6IW3 6JCK
  • DIP: 34433
  • STRING: ENSP00000005340
• Other Databases: GeneCards:  DVL2  Malacards:  DVL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	TAS	molecular function
GO:0150012	positive regulation of neuron projection arborization	ISS	biological process
GO:0035567	non-canonical Wnt signaling pathway	TAS	biological process
GO:0060070	canonical Wnt signaling pathway	TAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005109	frizzled binding	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035329	hippo signaling	TAS	biological process
GO:0045334	clathrin-coated endocytic vesicle	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060029	convergent extension involved in organogenesis	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0150012	positive regulation of neuron projection arborization	IEA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IEA	biological process
GO:0090103	cochlea morphogenesis	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0043621	protein self-association	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0035282	segmentation	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0030674	protein-macromolecule adaptor activity	IEA	molecular function
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0022007	convergent extension involved in neural plate elongation	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0007379	segment specification	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005109	frizzled binding	IEA	molecular function
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0044340	canonical Wnt signaling pathway involved in regulation of cell proliferation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IDA	biological process
GO:0035567	non-canonical Wnt signaling pathway	IMP	biological process
GO:0001843	neural tube closure	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0003151	outflow tract morphogenesis	ISS	biological process
GO:0007379	segment specification	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0043507	positive regulation of JUN kinase activity	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)