• Gene id: 1852

Gene Summary

• Gene Symbol: DUSP9   Gene   UCSC   Ensembl
• Aliases: MKP-4, MKP4
• Gene name: dual specificity phosphatase 9
• Alternate names: dual specificity protein phosphatase 9, map kinase phosphatase 4, mitogen-activated protein kinase phosphatase 4, serine/threonine specific protein phosphatase,
• Gene location: Xq28 (153642440: 153651325)     Exons: 7     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu
• OMIM: 609960

Protein Summary

• Protein general information: Q99956  
  • Name: Dual specificity protein phosphatase 9 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen activated protein kinase phosphatase 4) (MAP kinase phosphatase 4) (MKP 4)
  • Length: 384  
  • Mass: 41868
• Sequence:

  MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLSVRALLPGPPLQPPPP
  APVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSRFQAECPHLCETSLAGRAGSSM
  APVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESL
  AKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
  TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQASAASNPPSFFTTPTS
  DGAFELAPT

• Structural information:
  • Protein Domains: (18..13-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (203..38-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR008343  IPR029021  IPR001763  IPR036873   IPR000387  IPR020422  
  • Prosite: PS50206 PS50056 PS50054
  • PDB: 2HXP 3LJ8
  • PDBsum: 2HXP 3LJ8
  • STRING: ENSP00000345853
• Other Databases: GeneCards:  DUSP9  Malacards:  DUSP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IBA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0000188	inactivation of MAPK activity	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881