• Gene id: 1850

Gene Summary

• Gene Symbol: DUSP8   Gene   UCSC   Ensembl
• Aliases: C11orf81, HB5, HVH-5, HVH8
• Gene name: dual specificity phosphatase 8
• Alternate names: dual specificity protein phosphatase 8, H1 phosphatase, vaccinia virus homolog, dual specificity protein phosphatase hVH-5, serine/threonine specific protein phosphatase,
• Gene location: 11p15.5 (1572838: 1554050)     Exons: 9     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu
• OMIM: 602038

Protein Summary

• Protein general information: Q13202  
  • Name: Dual specificity protein phosphatase 8 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH 5)
  • Length: 625  
  • Mass: 65827
  • Tissue specificity: Abundant in brain, heart and skeletal muscle. {ECO
• Sequence:

  MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQQGKVTIAELIQPAAR
  SQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVAILTGGFATFSSCFPGLCEGKPAALLPMSLS
  QPCLPVPSVGLTRILPHLYLGSQKDVLNKDLMTQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWL
  DKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
  KLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREGGLSAGGEPPAPPTPPATSALQQGLR
  GLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGPGPPDPGEAPKLCKLDSPSGAALGLSSPSPDSPDAAPEAR
  PRPRRRPRPPAGSPARSPAHSLGLNFGDAARQTPRHGLSALSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWC
  FSPEGAQGAGGVLFAPFGRAGAPGPGGGSDLRRREAARAEPRDARTGWPEEPAPETQFKRRSCQMEFEEGMVEGR
  ARGEELAALGKQASFSGSVEVIEVS

• Structural information:
  • Protein Domains: (23..13-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (162..43-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR008343  IPR029021  IPR001763  IPR036873   IPR016130  IPR000387  IPR020422  
  • Prosite: PS50206 PS00383 PS50056 PS50054
  • PDB: 4JMK
  • PDBsum: 4JMK
  • STRING: ENSP00000380530
• Other Databases: GeneCards:  DUSP8  Malacards:  DUSP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0016311	dephosphorylation	ISS	biological process
GO:0016791	phosphatase activity	ISS	molecular function
GO:0000188	inactivation of MAPK activity	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq