• Gene id: 1849

Gene Summary

• Gene Symbol: DUSP7   Gene   UCSC   Ensembl
• Aliases: MKPX, PYST2
• Gene name: dual specificity phosphatase 7
• Alternate names: dual specificity protein phosphatase 7, dual specificity protein phosphatase PYST2,
• Gene location: 3p21.2 (52056570: 52048918)     Exons: 3     NC_000003.12
• Gene summary(Entrez): Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues.
• OMIM: 602669

Protein Summary

• Protein general information: Q16829  
  • Name: Dual specificity protein phosphatase 7 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PYST2)
  • Length: 419  
  • Mass: 44957
  • Tissue specificity: Strongly expressed in liver (PubMed
• Sequence:

  MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWLQEELEARGGASLLLL
  DCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAP
  ASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDREL
  PSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISD
  HWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFM
  GQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLFPLNTLEST

• Structural information:
  • Protein Domains: (68..18-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (308..37-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR000340  IPR008343  IPR029021  IPR001763  IPR036873   IPR000387  IPR020422  
  • Prosite: PS50206 PS50056 PS50054
  • PDB: 4Y2E
  • PDBsum: 4Y2E
  • STRING: ENSP00000417183
• Other Databases: GeneCards:  DUSP7  Malacards:  DUSP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043407	negative regulation of MAP kinase activity	IBA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq