• Gene id: 1845

Gene Summary

• Gene Symbol: DUSP3   Gene   UCSC   Ensembl
• Aliases: VHR
• Gene name: dual specificity phosphatase 3
• Alternate names: dual specificity protein phosphatase 3, dual specificity protein phosphatase VHR, serine/threonine specific protein phosphatase, vaccinia H1-related phosphatase, vaccinia virus phosphatase VH1-related,
• Gene location: 17q21.31 (43778976: 43766124)     Exons: 3     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu
• OMIM: 603726

Protein Summary

• Protein general information: P51452  
  • Name: Dual specificity protein phosphatase 3 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase VHR) (Vaccinia H1 related phosphatase) (VHR)
  • Length: 185  
  • Mass: 20478
• Sequence:

  MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNA
  NFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSA
  LSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

• Structural information:
  • Protein Domains: (99..16-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR020405  IPR000340  IPR029021  IPR016130   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 1J4X 1VHR 3F81
  • PDBsum: 1J4X 1VHR 3F81
  • STRING: ENSP00000226004
• Other Databases: GeneCards:  DUSP3  Malacards:  DUSP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033549	MAP kinase phosphatase activity	IBA	molecular function
GO:0046329	negative regulation of JNK cascade	IBA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IBA	biological process
GO:0050868	negative regulation of T cell activation	IBA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0045931	positive regulation of mitotic cell cycle	IBA	biological process
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008092	cytoskeletal protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	ISS	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IMP	biological process
GO:0050922	negative regulation of chemotaxis	IMP	biological process
GO:0120183	positive regulation of focal adhesion disassembly	IMP	biological process
GO:0051893	regulation of focal adhesion assembly	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0050868	negative regulation of T cell activation	IDA	biological process
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0046329	negative regulation of JNK cascade	IMP	biological process
GO:0043409	negative regulation of MAPK cascade	IMP	biological process
GO:0033549	MAP kinase phosphatase activity	IMP	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IMP	molecular function
GO:0000188	inactivation of MAPK activity	IMP	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq