• Gene id: 1844

Gene Summary

• Gene Symbol: DUSP2   Gene   UCSC   Ensembl
• Aliases: PAC-1, PAC1
• Gene name: dual specificity phosphatase 2
• Alternate names: dual specificity protein phosphatase 2, dual specificity protein phosphatase PAC-1, serine/threonine specific protein phosphatase,
• Gene location: 2q11.2 (96145467: 96143165)     Exons: 3     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively r
• OMIM: 300344

Protein Summary

• Protein general information: Q05923  
  • Name: Dual specificity protein phosphatase 2 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PAC 1)
  • Length: 314  
  • Mass: 34400
  • Tissue specificity: Expressed in hematopoietic tissues.
• Sequence:

  MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLPDRA
  LRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCPDLCSEAPAPA
  LPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVE
  DNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF
  MGQLLQFETQVLCH

• Structural information:
  • Protein Domains: (23..14-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (237..30-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR008343  IPR029021  IPR001763  IPR036873   IPR016130  IPR003595  IPR000387  IPR020422  
  • Prosite: PS50206 PS00383 PS50056 PS50054
  • PDB: 1M3G
  • PDBsum: 1M3G
  • STRING: ENSP00000288943
• Other Databases: GeneCards:  DUSP2  Malacards:  DUSP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0001706	endoderm formation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008330	protein tyrosine/threonine phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0000188	inactivation of MAPK activity	TAS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray