• Gene id: 1843

Gene Summary

• Gene Symbol: DUSP1   Gene   UCSC   Ensembl
• Aliases: CL100, HVH1, MKP-1, MKP1, PTPN10
• Gene name: dual specificity phosphatase 1
• Alternate names: dual specificity protein phosphatase 1, CL 100, MAP kinase phosphatase 1, dual specificity protein phosphatase hVH1, mitogen-activated protein kinase phosphatase 1, protein-tyrosine phosphatase CL100, serine/threonine specific protein phosphatase,
• Gene location: 5q35.1 (172771194: 172768095)     Exons: 4     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play
• OMIM: 616995

Protein Summary

• Protein general information: P28562  
  • Name: Dual specificity protein phosphatase 1 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH1) (Mitogen activated protein kinase phosphatase 1) (MAP kinase phosphatase 1) (MKP 1) (Protein tyrosine phosphatase CL100)
  • Length: 367  
  • Mass: 39298
  • Tissue specificity: Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney. {ECO
• Sequence:

  MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRL
  LAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLS
  TSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPV
  EDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
  FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

• Structural information:
  • Protein Domains: (20..13-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (175..36-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR000340  IPR008343  IPR029021  IPR001763   IPR036873  IPR016130  IPR003595  IPR000387  IPR020422  
  • Prosite: PS50206 PS00383 PS50056 PS50054
  • PDB: 6APX 6D65 6D66 6D67
  • PDBsum: 6APX 6D65 6D66 6D67
  • STRING: ENSP00000239223
• Other Databases: GeneCards:  DUSP1  Malacards:  DUSP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:1903753	negative regulation of p38MAPK cascade	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0001706	endoderm formation	IBA	biological process
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	ISS	molecular function
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS	molecular function
GO:0070262	peptidyl-serine dephosphorylation	ISS	biological process
GO:0004722	protein serine/threonine phosphatase activity	ISS	molecular function
GO:0035970	peptidyl-threonine dephosphorylation	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0070262	peptidyl-serine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IEA	biological process
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008330	protein tyrosine/threonine phosphatase activity	IEA	molecular function
GO:0009416	response to light stimulus	IEA	biological process
GO:0019838	growth factor binding	IEA	molecular function
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090027	negative regulation of monocyte chemotaxis	IMP	biological process
GO:1990869	cellular response to chemokine	IMP	biological process
GO:0007162	negative regulation of cell adhesion	IMP	biological process
GO:1903753	negative regulation of p38MAPK cascade	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IDA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	ISS	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS	molecular function
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	ISS	biological process
GO:0071850	mitotic cell cycle arrest	ISS	biological process
GO:0051447	negative regulation of meiotic cell cycle	ISS	biological process
GO:0043409	negative regulation of MAPK cascade	ISS	biological process
GO:0035970	peptidyl-threonine dephosphorylation	ISS	biological process
GO:0000188	inactivation of MAPK activity	ISS	biological process
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:1903753	negative regulation of p38MAPK cascade	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0001706	endoderm formation	IBA	biological process
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	ISS	molecular function
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS	molecular function
GO:0070262	peptidyl-serine dephosphorylation	ISS	biological process
GO:0004722	protein serine/threonine phosphatase activity	ISS	molecular function
GO:0035970	peptidyl-threonine dephosphorylation	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0070262	peptidyl-serine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IEA	biological process
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008330	protein tyrosine/threonine phosphatase activity	IEA	molecular function
GO:0009416	response to light stimulus	IEA	biological process
GO:0019838	growth factor binding	IEA	molecular function
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090027	negative regulation of monocyte chemotaxis	IMP	biological process
GO:1990869	cellular response to chemokine	IMP	biological process
GO:0007162	negative regulation of cell adhesion	IMP	biological process
GO:1903753	negative regulation of p38MAPK cascade	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IDA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	ISS	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS	molecular function
GO:0090266	regulation of mitotic cell cycle spindle assembly checkpoint	ISS	biological process
GO:0071850	mitotic cell cycle arrest	ISS	biological process
GO:0051447	negative regulation of meiotic cell cycle	ISS	biological process
GO:0043409	negative regulation of MAPK cascade	ISS	biological process
GO:0035970	peptidyl-threonine dephosphorylation	ISS	biological process
GO:0000188	inactivation of MAPK activity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05012	Parkinson disease
hsa05418	Fluid shear stress and atherosclerosis
hsa04726	Serotonergic synapse

Diseases

Associated diseases	References
Prostate cancer	PMID:9010448
urinary bladder cancer	PMID:17690186
Major depressive disorder	PMID:20953200
Breast cancer	PMID:19417026
Breast cancer	PMID:9724088
Breast cancer	PMID:12618338
Breast cancer	PMID:22333693
Squamous cell carcinoma	PMID:23892499
ovarian carcinoma	PMID:12432554
Psoriasis	PMID:22924482
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray