• Gene id: 1842

Gene Summary

• Gene Symbol: ECM2   Gene   UCSC   Ensembl
• Gene name: extracellular matrix protein 2
• Alternate names: extracellular matrix protein 2, extracellular matrix protein 2, female organ and adipocyte specific, matrix glycoprotein SC1/ECM2,
• Gene location: 9q22.31 (92536840: 92493546)     Exons: 9     NC_000009.12
• Gene summary(Entrez): ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
• OMIM: 603479

Protein Summary

• Protein general information: O94769  
  • Name: Extracellular matrix protein 2 (Matrix glycoprotein SC1/ECM2)
  • Length: 699  
  • Mass: 79789
  • Tissue specificity: Expressed predominantly in adipose tissue as well as female-specific organs such as mammary gland, ovary, and uterus. {ECO
• Sequence:

  MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIVNFDYS
  MEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCPQTVIPE
  GECCPVCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTE
  QKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRM
  PSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGLPNLERLDLS
  KNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSDLNQLVTLELEGNNL
  SEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENR
  IAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDR
  VSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIR
  EIPSYTFSCIRSYSSIVLKPQNIK

• Structural information:
  • Protein Domains: (101..15-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (307..34-)
    (/note="LRRNT"-)
  • Interpro: IPR001611  IPR025875  IPR003591  IPR032675  IPR001007  
  • Prosite: PS51450 PS01208 PS50184
  • STRING: ENSP00000344758
• Other Databases: GeneCards:  ECM2  Malacards:  ECM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010811	positive regulation of cell-substrate adhesion	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0070052	collagen V binding	IBA	molecular function
GO:0008201	heparin binding	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005178	integrin binding	TAS	molecular function
GO:0031012	extracellular matrix	TAS	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0070052	collagen V binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005614	interstitial matrix	IEA	cellular component
GO:0005518	collagen binding	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)