• Gene id: 1841

Gene Summary

• Gene Symbol: DTYMK   Gene   UCSC   Ensembl
• Aliases: CDC8, PP3731, TMPK, TYMK
• Gene name: deoxythymidylate kinase
• Alternate names: thymidylate kinase, dTMP kinase, deoxythymidylate kinase (thymidylate kinase),
• Gene location: 2q37.3 (241686814: 241675746)     Exons: 7     NC_000002.12
• OMIM: 615315

Protein Summary

• Protein general information: P23919  
  • Name: Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)
  • Length: 212  
  • Mass: 23819
• Sequence:

  MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSAN
  RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHER
  YENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK

• Structural information:
  • Interpro: IPR027417  IPR039430  IPR018095  IPR018094  
  • Prosite: PS01331
  • PDB: 1E2D 1E2E 1E2F 1E2G 1E2Q 1E98 1E99 1E9A 1E9B 1E9C 1E9D 1E9E 1E9F 1NMX 1NMY 1NMZ 1NN0 1NN1 1NN3 1NN5 2XX3
  • PDBsum: 1E2D 1E2E 1E2F 1E2G 1E2Q 1E98 1E99 1E9A 1E9B 1E9C 1E9D 1E9E 1E9F 1NMX 1NMY 1NMZ 1NN0 1NN1 1NN3 1NN5 2XX3
  • STRING: ENSP00000304802
• Other Databases: GeneCards:  DTYMK  Malacards:  DTYMK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004798	thymidylate kinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006233	dTDP biosynthetic process	IBA	biological process
GO:0006235	dTTP biosynthetic process	IBA	biological process
GO:0009041	uridylate kinase activity	IBA	molecular function
GO:0004550	nucleoside diphosphate kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0006227	dUDP biosynthetic process	IBA	biological process
GO:0004798	thymidylate kinase activity	IEA	molecular function
GO:0006233	dTDP biosynthetic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0009165	nucleotide biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004798	thymidylate kinase activity	TAS	molecular function
GO:0004798	thymidylate kinase activity	IEA	molecular function
GO:0004798	thymidylate kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0009165	nucleotide biosynthetic process	IEA	biological process
GO:0006233	dTDP biosynthetic process	IEA	biological process
GO:0004798	thymidylate kinase activity	IEA	molecular function
GO:0046686	response to cadmium ion	IEA	biological process
GO:0045445	myoblast differentiation	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0006235	dTTP biosynthetic process	IEA	biological process
GO:0006233	dTDP biosynthetic process	IEA	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0046105	thymidine biosynthetic process	TAS	biological process
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0006235	dTTP biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq