• Gene id: 1831

Gene Summary

• Gene Symbol: TSC22D3   Gene   UCSC   Ensembl
• Aliases: DIP, DSIPI, GILZ, TSC-22R
• Gene name: TSC22 domain family member 3
• Alternate names: TSC22 domain family protein 3, DSIP-immunoreactive leucine zipper protein, DSIP-immunoreactive peptide, TSC-22 related protein, TSC-22-like protein, delta sleep-inducing peptide immunoreactor, glucocorticoid-induced leucine zipper protein,
• Gene location: Xq22.3 (107777328: 107713220)     Exons: 8     NC_000023.11
• Gene summary(Entrez): This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects o
• OMIM: 300506

Protein Summary

• Protein general information: Q99576  
  • Name: TSC22 domain family protein 3 (DSIP immunoreactive peptide) (Protein DIP) (hDIP) (Delta sleep inducing peptide immunoreactor) (Glucocorticoid induced leucine zipper protein) (GILZ) (TSC 22 like protein) (TSC 22 related protein) (TSC 22R)
  • Length: 134  
  • Mass: 14,810
• Sequence:

  MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEI
  LKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV

• Structural information:
  • Interpro: IPR000580  
  • Prosite: PS01289
  • STRING: ENSP00000314655
• Other Databases: GeneCards:  TSC22D3  Malacards:  TSC22D3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0006970	response to osmotic stress	IEA	biological process
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0043426	MRF binding	IEA	molecular function
GO:0048642	negative regulation of skeletal muscle tissue development	IEA	biological process
GO:0070236	negative regulation of activation-induced cell death of T cells	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0006970	response to osmotic stress	IEA	biological process
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0043426	MRF binding	IEA	molecular function
GO:0048642	negative regulation of skeletal muscle tissue development	IEA	biological process
GO:0070236	negative regulation of activation-induced cell death of T cells	IEA	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0034220	ion transmembrane transport	TAS	biological process

Diseases

Associated diseases	References
Diabetes	GAD: 11688842
Diabetes	GAD: 11688842
Sertoli cell only syndrome (SCOS)	MIK: 23494955
Non obstructive azoospermia	MIK: 23494955
Male factor infertility	MIK: 23494955
Male factor infertility	MIK: 22556341
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with testis development	MIK: 22556341
Essential for spermatogonial survival and spermatogenesis	MIK: 22571926
Hypospermatogenesis	MIK: 28361989
Regulates spermatogonial maintenance	MIK: 30126904
Sertoli cell only (SCO) syndrome	MIK: 23494955
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23494955	Sertoli cell only (SCO) syndrome, non-obstructive azoospermia (NOA)	107018665 G>A, 107018485 C>G, 106959283 C>T	America n, Aust ralian	497 (203infertile men (65 SCO, 52 NOA, 86 SCO), 294 controls)	Male infertility
30126904	Regulates spermatogonial maintenance				Male infertility
22571926	Essential for spermatogonial survival and spermatogenesis				Male infertility
22556341	Associated with testis development				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray