• Gene id: 183

Gene Summary

• Gene Symbol: AGT   Gene   UCSC   Ensembl
• Aliases: ANHU, SERPINA8, hFLT1
• Gene name: angiotensinogen
• Alternate names: angiotensinogen, alpha-1 antiproteinase, antitrypsin, angiotensin I, angiotensin II, fetal-liver predominant transporter 1, pre-angiotensinogen, serine (or cysteine) proteinase inhibitor, serpin A8, serpin peptidase inhibitor, clade A, member 8,
• Gene location: 1q42.2 (230714121: 230702522)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin co
• OMIM: 601381

Protein Summary

• Protein general information: P01019  
  • Name: Angiotensinogen (Serpin A8) [Cleaved into: Angiotensin 1 (Angiotensin 1 10) (Angiotensin I) (Ang I); Angiotensin 2 (Angiotensin 1 8) (Angiotensin II) (Ang II); Angiotensin 3 (Angiotensin 2 8) (Angiotensin III) (Ang III) (Des Asp[1] angiotensin II); Angiot
  • Length: 485  
  • Mass: 53154
  • Tissue specificity: Expressed by the liver and secreted in plasma.
• Sequence:

  MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAK
  TSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGA
  LDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQ
  GLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
  WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPR
  TIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPE
  VLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA

• Structural information:
  • Interpro: IPR000227  IPR033834  IPR023795  IPR023796  IPR000215   IPR036186  IPR042178  IPR042185  
  • Prosite: PS00284
  • CDD: cd02054
  • PDB: 1N9U 1N9V 2JP8 2WXW 2X0B 3CK0 3WOO 3WOR 4AA1 4APH 4FYS 5E2Q 5M3X 5M3Y 5XJM 6I3F 6I3I
  • PDBsum: 1N9U 1N9V 2JP8 2WXW 2X0B 3CK0 3WOO 3WOR 4AA1 4APH 4FYS 5E2Q 5M3X 5M3Y 5XJM 6I3F 6I3I
  • DIP: 309
  • STRING: ENSP00000355627
• Other Databases: GeneCards:  AGT  Malacards:  AGT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043407	negative regulation of MAP kinase activity	IMP	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042310	vasoconstriction	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003051	angiotensin-mediated drinking behavior	IEA	biological process
GO:0003331	positive regulation of extracellular matrix constituent secretion	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0006883	cellular sodium ion homeostasis	IEA	biological process
GO:0007202	activation of phospholipase C activity	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0010666	positive regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0014061	regulation of norepinephrine secretion	IEA	biological process
GO:0014824	artery smooth muscle contraction	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032930	positive regulation of superoxide anion generation	IEA	biological process
GO:0035106	operant conditioning	IEA	biological process
GO:0035813	regulation of renal sodium excretion	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0048144	fibroblast proliferation	IEA	biological process
GO:0048659	smooth muscle cell proliferation	IEA	biological process
GO:0051403	stress-activated MAPK cascade	IEA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0061049	cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070471	uterine smooth muscle contraction	IEA	biological process
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IEA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IEA	biological process
GO:1905589	positive regulation of L-arginine import across plasma membrane	IEA	biological process
GO:0002018	renin-angiotensin regulation of aldosterone production	IEA	biological process
GO:0002027	regulation of heart rate	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0014873	response to muscle activity involved in regulation of muscle adaptation	IEA	biological process
GO:0034104	negative regulation of tissue remodeling	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0042310	vasoconstriction	IEA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0050663	cytokine secretion	IEA	biological process
GO:0051969	regulation of transmission of nerve impulse	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:1904385	cellular response to angiotensin	IEA	biological process
GO:1905010	positive regulation of L-lysine import across plasma membrane	IEA	biological process
GO:0031703	type 2 angiotensin receptor binding	IPI	molecular function
GO:0005179	hormone activity	IC	molecular function
GO:0005179	hormone activity	ISS	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0031702	type 1 angiotensin receptor binding	IPI	molecular function
GO:0005615	extracellular space	IC	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0001558	regulation of cell growth	NAS	biological process
GO:0001819	positive regulation of cytokine production	TAS	biological process
GO:0001822	kidney development	IMP	biological process
GO:0001974	blood vessel remodeling	TAS	biological process
GO:0002016	regulation of blood volume by renin-angiotensin	NAS	biological process
GO:0002019	regulation of renal output by angiotensin	NAS	biological process
GO:0002034	regulation of blood vessel diameter by renin-angiotensin	TAS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	NAS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	ISS	biological process
GO:0033864	positive regulation of NAD(P)H oxidase activity	TAS	biological process
GO:0035813	regulation of renal sodium excretion	NAS	biological process
GO:0042127	regulation of cell population proliferation	NAS	biological process
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0010873	positive regulation of cholesterol esterification	IDA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IDA	biological process
GO:0051387	negative regulation of neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0002018	renin-angiotensin regulation of aldosterone production	NAS	biological process
GO:0007199	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	TAS	biological process
GO:0007263	nitric oxide mediated signal transduction	TAS	biological process
GO:0014873	response to muscle activity involved in regulation of muscle adaptation	ISS	biological process
GO:0019229	regulation of vasoconstriction	NAS	biological process
GO:0034374	low-density lipoprotein particle remodeling	NAS	biological process
GO:0048146	positive regulation of fibroblast proliferation	ISS	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	TAS	biological process
GO:1903598	positive regulation of gap junction assembly	IGI	biological process
GO:0008217	regulation of blood pressure	IGI	biological process
GO:1903779	regulation of cardiac conduction	IGI	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:1901201	regulation of extracellular matrix assembly	IGI	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis	IDA	biological process
GO:0003014	renal system process	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0010536	positive regulation of activation of Janus kinase activity	IMP	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04072	Phospholipase D signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa04925	Aldosterone synthesis and secretion
hsa04931	Insulin resistance
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04924	Renin secretion
hsa04927	Cortisol synthesis and secretion
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Renal tubular dysgenesis	KEGG:H00575
Renal tubular dysgenesis	KEGG:H00575
Inflammatory bowel disease	PMID:20717043
Atrial fibrillation	PMID:18239384
Pre-eclampsia	PMID:20530295
Pre-eclampsia	PMID:8513325
Alzheimer's disease	PMID:21297254
Hypertension	PMID:21312059
Hydronephrosis	PMID:12399452
Henoch-Schoenlein purpura	PMID:16521052
Henoch-Schoenlein purpura	PMID:20702504
Pulmonary edema	PMID:21393362
hypertrophic cardiomyopathy	PMID:9023164
otosclerosis	PMID:18491423
Sick sinus syndrome	PMID:22242192
Fabry disease	PMID:24020479
Diffuse scleroderma	PMID:14730619
Breast cancer	PMID:23374911
Breast cancer	PMID:23828384
Breast cancer	PMID:16823505
Hyperinsulinism	PMID:16713443
Multiple sclerosis	PMID:17715340
Carotid artery disease	PMID:17220293
systemic scleroderma	PMID:17360781
Myocardial infarction	PMID:17299437
congestive heart failure	PMID:24465706
congestive heart failure	PMID:17145981
cerebrovascular disease	PMID:17220293
chronic myeloid leukemia	PMID:19761684
intermediate coronary syndrome	PMID:11451295
skin melanoma	PMID:19394758
Diabetic retinopathy	PMID:10862638
type 2 diabetes mellitus	PMID:17170378
Mitral valve prolapse	PMID:17379330
obesity	PMID:16713443
obesity	PMID:16514903
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq