• Gene id: 1819

Gene Summary

• Gene Symbol: DRG2   Gene   UCSC   Ensembl
• Gene name: developmentally regulated GTP binding protein 2
• Alternate names: developmentally-regulated GTP-binding protein 2, TRAFAC GTPase DRG2, translation factor GTPase DRG2,
• Gene location: 17p11.2 (18087884: 18107969)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene encodes a GTP-binding protein known to function in the regulation of cell growth and differentiation. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein.
• OMIM: 153240

Protein Summary

• Protein general information: P55039  
  • Name: Developmentally regulated GTP binding protein 2 (DRG 2) (Translation factor GTPase DRG2) (TRAFAC GTPase DRG2) (EC 3.6.5. )
  • Length: 364  
  • Mass: 40746
  • Tissue specificity: Highest levels in skeletal muscle, heart and kidney. Low levels in colon, thymus, spleen, small intestine, lung and Leukocytes.
• Sequence:

  MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGFPSVGK
  STFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADVIIMMLDAT
  KGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSP
  DEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQR
  PDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQIVKK

• Structural information:
  • Protein Domains: (63..28-)
    (/note="OBG-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01047-)
    (288..36-)
    (/note="TGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01228"-)
  • Interpro: IPR012675  IPR031167  IPR031662  IPR006074  IPR006073   IPR027417  IPR005225  IPR004095  IPR012676  
  • Prosite: PS51710 PS00905 PS51880
  • STRING: ENSP00000225729
• Other Databases: GeneCards:  DRG2  Malacards:  DRG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005525	GTP binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray