• Gene id: 1813

Gene Summary

• Gene Symbol: DRD2   Gene   UCSC   Ensembl
• Aliases: D2DR, D2R
• Gene name: dopamine receptor D2
• Alternate names: D(2) dopamine receptor, dopamine D2 receptor, dopamine receptor D2 isoform, seven transmembrane helix receptor,
• Gene location: 11q23.2 (113475397: 113409594)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative
• OMIM: 601920

Protein Summary

• Protein general information: P14416  
  • Name: D(2) dopamine receptor (Dopamine D2 receptor)
  • Length: 443  
  • Mass: 50619
• Sequence:

  MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS
  LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR
  RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT
  KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
  SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML
  AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

• Structural information:
  • Interpro: IPR001922  IPR000929  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1I15 5AER 6CM4
  • PDBsum: 1I15 5AER 6CM4
  • DIP: 5977
  • STRING: ENSP00000354859
• Other Databases: GeneCards:  DRD2  Malacards:  DRD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060079	excitatory postsynaptic potential	NAS	biological process
GO:0051898	negative regulation of protein kinase B signaling	NAS	biological process
GO:0097730	non-motile cilium	IDA	cellular component
GO:0060170	ciliary membrane	IDA	cellular component
GO:1900168	positive regulation of glial cell-derived neurotrophic factor secretion	IDA	biological process
GO:1901386	negative regulation of voltage-gated calcium channel activity	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0071880	adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	biological process
GO:0060158	phospholipase C-activating dopamine receptor signaling pathway	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0001963	synaptic transmission, dopaminergic	IBA	biological process
GO:0099056	integral component of presynaptic membrane	IBA	cellular component
GO:0051967	negative regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0051481	negative regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0043266	regulation of potassium ion transport	IBA	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0001591	dopamine neurotransmitter receptor activity, coupled via Gi/Go	IBA	molecular function
GO:0004952	dopamine neurotransmitter receptor activity	IEA	molecular function
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005929	cilium	IDA	cellular component
GO:0060158	phospholipase C-activating dopamine receptor signaling pathway	IGI	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051580	regulation of neurotransmitter uptake	IEA	biological process
GO:0051586	positive regulation of dopamine uptake involved in synaptic transmission	IEA	biological process
GO:0060124	positive regulation of growth hormone secretion	IEA	biological process
GO:0060158	phospholipase C-activating dopamine receptor signaling pathway	IEA	biological process
GO:0060160	negative regulation of dopamine receptor signaling pathway	IEA	biological process
GO:0098691	dopaminergic synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0004952	dopamine neurotransmitter receptor activity	IEA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA	biological process
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0021756	striatum development	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031223	auditory behavior	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0033602	negative regulation of dopamine secretion	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0042321	negative regulation of circadian sleep/wake cycle, sleep	IEA	biological process
GO:0042756	drinking behavior	IEA	biological process
GO:0043408	regulation of MAPK cascade	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0051823	regulation of synapse structural plasticity	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0090325	regulation of locomotion involved in locomotory behavior	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:1901386	negative regulation of voltage-gated calcium channel activity	IEA	biological process
GO:0001964	startle response	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0002028	regulation of sodium ion transport	IEA	biological process
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0004952	dopamine neurotransmitter receptor activity	IEA	molecular function
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IEA	biological process
GO:0007270	neuron-neuron synaptic transmission	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030432	peristalsis	IEA	biological process
GO:0032228	regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0042417	dopamine metabolic process	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0048148	behavioral response to cocaine	IEA	biological process
GO:0051584	regulation of dopamine uptake involved in synaptic transmission	IEA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IEA	biological process
GO:0051967	negative regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060134	prepulse inhibition	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0001591	dopamine neurotransmitter receptor activity, coupled via Gi/Go	IEA	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0002031	G protein-coupled receptor internalization	IEA	biological process
GO:0002092	positive regulation of receptor internalization	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0010039	response to iron ion	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0014854	response to inactivity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0021769	orbitofrontal cortex development	IEA	biological process
GO:0030139	endocytic vesicle	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0030900	forebrain development	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0035240	dopamine binding	IEA	molecular function
GO:0036126	sperm flagellum	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043197	dendritic spine	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043266	regulation of potassium ion transport	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046717	acid secretion	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0051481	negative regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:0001591	dopamine neurotransmitter receptor activity, coupled via Gi/Go	IEA	molecular function
GO:0001659	temperature homeostasis	IEA	biological process
GO:0001976	nervous system process involved in regulation of systemic arterial blood pressure	IEA	biological process
GO:0002027	regulation of heart rate	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0021853	cerebral cortex GABAergic interneuron migration	IEA	biological process
GO:0021984	adenohypophysis development	IEA	biological process
GO:0030534	adult behavior	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0035240	dopamine binding	IEA	molecular function
GO:0035810	positive regulation of urine volume	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043266	regulation of potassium ion transport	IEA	biological process
GO:0043473	pigmentation	IEA	biological process
GO:0048149	behavioral response to ethanol	IEA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0048755	branching morphogenesis of a nerve	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0001591	dopamine neurotransmitter receptor activity, coupled via Gi/Go	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	IDA	biological process
GO:0042417	dopamine metabolic process	IC	biological process
GO:0001975	response to amphetamine	ISS	biological process
GO:0002028	regulation of sodium ion transport	ISS	biological process
GO:0002052	positive regulation of neuroblast proliferation	ISS	biological process
GO:0007270	neuron-neuron synaptic transmission	ISS	biological process
GO:0007626	locomotory behavior	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030432	peristalsis	ISS	biological process
GO:0032228	regulation of synaptic transmission, GABAergic	ISS	biological process
GO:0043278	response to morphine	ISS	biological process
GO:0045776	negative regulation of blood pressure	ISS	biological process
GO:0048148	behavioral response to cocaine	ISS	biological process
GO:0051586	positive regulation of dopamine uptake involved in synaptic transmission	ISS	biological process
GO:0060124	positive regulation of growth hormone secretion	ISS	biological process
GO:0060160	negative regulation of dopamine receptor signaling pathway	ISS	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0034776	response to histamine	IDA	biological process
GO:0050482	arachidonic acid secretion	IDA	biological process
GO:0050709	negative regulation of protein secretion	IDA	biological process
GO:0051584	regulation of dopamine uptake involved in synaptic transmission	IC	biological process
GO:0001659	temperature homeostasis	ISS	biological process
GO:0001976	nervous system process involved in regulation of systemic arterial blood pressure	ISS	biological process
GO:0002027	regulation of heart rate	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0007608	sensory perception of smell	ISS	biological process
GO:0007628	adult walking behavior	ISS	biological process
GO:0008104	protein localization	ISS	biological process
GO:0008306	associative learning	ISS	biological process
GO:0008542	visual learning	ISS	biological process
GO:0009416	response to light stimulus	ISS	biological process
GO:0021853	cerebral cortex GABAergic interneuron migration	ISS	biological process
GO:0021984	adenohypophysis development	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0042220	response to cocaine	ISS	biological process
GO:0042493	response to drug	ISS	biological process
GO:0043266	regulation of potassium ion transport	ISS	biological process
GO:0048149	behavioral response to ethanol	ISS	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	ISS	biological process
GO:0048755	branching morphogenesis of a nerve	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0051898	negative regulation of protein kinase B signaling	ISS	biological process
GO:0051967	negative regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0060134	prepulse inhibition	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:1990384	hyaloid vascular plexus regression	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05012	Parkinson disease
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05034	Alcoholism
hsa04728	Dopaminergic synapse
hsa04540	Gap junction
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
migraine with aura	PMID:9513185
Alzheimer's disease	PMID:11087905
Hypertension	PMID:11494094
Mental depression	PMID:9513185
Anxiety disorder	PMID:9513185
Schizophrenia	PMID:20813060
type 2 diabetes mellitus	PMID:18834717
obesity	PMID:17108814
obesity	PMID:15939106
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq