• Gene id: 1811

Gene Summary

• Gene Symbol: SLC26A3   Gene   UCSC   Ensembl
• Aliases: CLD, DRA
• Gene name: solute carrier family 26 member 3
• Alternate names: chloride anion exchanger, down-regulated in adenoma protein, solute carrier family 26 (anion exchanger), member 3,
• Gene location: 7q22.3-q31.1 (107803222: 107765468)     Exons: 21     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of c
• OMIM: 126650

Protein Summary

• Protein general information: P40879  
  • Name: Chloride anion exchanger (Down regulated in adenoma) (Protein DRA) (Solute carrier family 26 member 3)
  • Length: 764  
  • Mass: 84505
• Sequence:

  MIEPFGNQYIVARPVYSTNAFEENHKKTGRHHKTFLDHLKVCCSCSPQKAKRIVLSLFPIASWLPAYRLKEWLLS
  DIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFGTSRHISVGPFPILSMMVGLAVSGAVSKAVP
  DRNATTLGLPNNSNNSSLLDDERVRVAAAASVTVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQ
  LKFIFQLTVPSHTDPVSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIA
  AGVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVAFAVAFSVASVYSLKYDYPLDGNQEL
  IALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAIIVLIVVLAIGFLLAPLQKSVLAALALGNLKG
  MLMQFAEIGRLWRKDKYDCLIWIMTFIFTIVLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKD
  YYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
  IKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFI
  RIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGG
  LRNRVYEVPVETKF

• Structural information:
  • Protein Domains: (525..72-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR018045  IPR011547  IPR001902  IPR030321  IPR002645   IPR036513  
  • Prosite: PS01130 PS50801
  • STRING: ENSP00000345873
• Other Databases: GeneCards:  SLC26A3  Malacards:  SLC26A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0097225	sperm midpiece	ISS	cellular component
GO:0071320	cellular response to cAMP	ISS	biological process
GO:0051454	intracellular pH elevation	ISS	biological process
GO:0015108	chloride transmembrane transporter activity	ISS	molecular function
GO:0060081	membrane hyperpolarization	ISS	biological process
GO:0048240	sperm capacitation	ISS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0015106	bicarbonate transmembrane transporter activity	ISS	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0015701	bicarbonate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005215	transporter activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0006820	anion transport	TAS	biological process
GO:0007588	excretion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097225	sperm midpiece	IEA	cellular component
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0051454	intracellular pH elevation	IEA	biological process
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0015108	chloride transmembrane transporter activity	IEA	molecular function
GO:0060081	membrane hyperpolarization	IEA	biological process
GO:0048240	sperm capacitation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015106	bicarbonate transmembrane transporter activity	IEA	molecular function
GO:0031526	brush border membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0019532	oxalate transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04972	Pancreatic secretion
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Congenital diarrhea	KEGG:H01174
Epididymis dysplasia and impaired sperm fertilization	MIK: 30118583
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
30118583	Epididymis dysplasia and impaired sperm fertilization				Male infertility