• Gene id: 1810

Gene Summary

• Gene Symbol: DR1   Gene   UCSC   Ensembl
• Aliases: NC2, NC2-BETA, NC2B, NCB2
• Gene name: down-regulator of transcription 1
• Alternate names: protein Dr1, TATA-binding protein-associated phosphoprotein, negative cofactor 2, negative cofactor 2-beta,
• Gene location: 1p22.1 (93345906: 93369492)     Exons: 3     NC_000001.11
• Gene summary(Entrez): This gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This pr
• OMIM: 601482

Protein Summary

• Protein general information: Q01658  
  • Name: Protein Dr1 (Down regulator of transcription 1) (Negative cofactor 2 beta) (NC2 beta) (TATA binding protein associated phosphoprotein)
  • Length: 176  
  • Mass: 19444
• Sequence:

  MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQAL
  ESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQ
  AQLAAASASASNQAGSSQDEEDDDDI

• Structural information:
  • Protein Domains: (12..7-)
    (/note="Histone-fold-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR003958  IPR009072  IPR042225  
  • PDB: 1JFI
  • PDBsum: 1JFI
  • STRING: ENSP00000359295
• Other Databases: GeneCards:  DR1  Malacards:  DR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IDA	contributes to
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001046	core promoter sequence-specific DNA binding	IBA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IBA	cellular component
GO:0017025	TBP-class protein binding	IBA	molecular function
GO:0017054	negative cofactor 2 complex	IBA	cellular component
GO:0045898	regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0006338	chromatin remodeling	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0017054	negative cofactor 2 complex	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0017025	TBP-class protein binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006366	transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray