• Gene id: 1809

Gene Summary

• Gene Symbol: DPYSL3   Gene   UCSC   Ensembl
• Aliases: CRMP-4, CRMP4, DRP-3, DRP3, LCRMP, ULIP, ULIP-1
• Gene name: dihydropyrimidinase like 3
• Alternate names: dihydropyrimidinase-related protein 3, collapsin response mediator protein 4 long, testicular secretory protein Li 7, unc-33-like phosphoprotein 1,
• Gene location: 5q32 (147510067: 147390807)     Exons: 16     NC_000005.10
• OMIM: 601168

Protein Summary

• Protein general information: Q14195  
  • Name: Dihydropyrimidinase related protein 3 (DRP 3) (Collapsin response mediator protein 4) (CRMP 4) (Unc 33 like phosphoprotein 1) (ULIP 1)
  • Length: 570  
  • Mass: 61963
  • Tissue specificity: Mainly expressed in heart and skeletal muscle. Also strongly expressed in fetal brain and spinal cord.
• Sequence:

  MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTH
  FQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQ
  EVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVL
  SRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAA
  FVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKM
  DENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQG
  KIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTR
  PNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS

• Structural information:
  • Interpro: IPR006680  IPR030628  IPR011778  IPR011059  IPR032466  
  • CDD: cd01314
  • PDB: 4BKN 4CNS 4CNT 4CNU
  • PDBsum: 4BKN 4CNS 4CNT 4CNU
  • STRING: ENSP00000343690
• Other Databases: GeneCards:  DPYSL3  Malacards:  DPYSL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016812	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA	molecular function
GO:0006208	pyrimidine nucleobase catabolic process	IBA	NOT|biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004157	dihydropyrimidinase activity	IBA	NOT|molecular function
GO:0051764	actin crosslink formation	IBA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA	molecular function
GO:0030334	regulation of cell migration	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031005	filamin binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0035374	chondroitin sulfate binding	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0031941	filamentous actin	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0048666	neuron development	IEA	biological process
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0051764	actin crosslink formation	IEA	biological process
GO:0070382	exocytic vesicle	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0035374	chondroitin sulfate binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0071345	cellular response to cytokine stimulus	ISS	biological process
GO:0070382	exocytic vesicle	ISS	colocalizes with
GO:0051764	actin crosslink formation	ISS	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0051017	actin filament bundle assembly	ISS	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0051491	positive regulation of filopodium assembly	ISS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0017124	SH3 domain binding	ISS	molecular function
GO:0071345	cellular response to cytokine stimulus	ISS	biological process
GO:0031941	filamentous actin	ISS	cellular component
GO:0010977	negative regulation of neuron projection development	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq