• Gene id: 1805

Gene Summary

• Gene Symbol: DPT   Gene   UCSC   Ensembl
• Aliases: TRAMP
• Gene name: dermatopontin
• Alternate names: dermatopontin, tyrosine-rich acidic matrix protein,
• Gene location: 1q24.2 (168729205: 168695467)     Exons: 4     NC_000001.11
• Gene summary(Entrez): Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the be
• OMIM: 120930

Protein Summary

• Protein general information: Q07507  
  • Name: Dermatopontin (Tyrosine rich acidic matrix protein) (TRAMP)
  • Length: 201  
  • Mass: 24005
  • Tissue specificity: Expressed in fibroblasts, heart, skeletal muscle, brain and pancreas. Expressed at an intermediate level in lung and kidney, and at a low level in liver and placenta. Expressed at a lower level in fibroblasts from hypertrophic scar les
• Sequence:

  MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNY
  ACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYP
  GHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

• Structural information:
  • Interpro: IPR026645  
  • STRING: ENSP00000356791
• Other Databases: GeneCards:  DPT  Malacards:  DPT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030199	collagen fibril organization	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	ISS	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Spermatogenic failure	MIK: 17921478

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray