• Gene id: 1804

Gene Summary

• Gene Symbol: DPP6   Gene   UCSC   Ensembl
• Aliases: DPL1, DPPX, MRD33, VF2
• Gene name: dipeptidyl peptidase like 6
• Alternate names: dipeptidyl aminopeptidase-like protein 6, DPP VI, dipeptidyl aminopeptidase IV-related protein, dipeptidyl peptidase IV-related protein, dipeptidyl peptidase VI, dipeptidyl-peptidase 6,
• Gene location: 7q36.2 (153747985: 154894289)     Exons: 32     NC_000007.14
• Gene summary(Entrez): This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in
• OMIM: 126141

Protein Summary

• Protein general information: P42658  
  • Name: Dipeptidyl aminopeptidase like protein 6 (DPPX) (Dipeptidyl aminopeptidase related protein) (Dipeptidyl peptidase 6) (Dipeptidyl peptidase IV like protein) (Dipeptidyl peptidase VI) (DPP VI)
  • Length: 865  
  • Mass: 97,588
• Sequence:

  MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQYQARS
  DGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSEDFKIHDPEAKW
  ISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIP
  HGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKT
  HIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPTHDLEMMPPDD
  PRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFIR
  AIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNR
  QCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIE
  IDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHE
  VRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYAS
  AFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHY
  FTSSSLKQHLYRSIINFFVECFRIQDKLLTVTAKEDEEED

• Structural information:
  • Interpro: IPR029058  IPR001375  IPR002469  IPR038554  
  • PDB: 1XFD
  • PDBsum: 1XFD
  • STRING: ENSP00000367001
• Other Databases: GeneCards:  DPP6  Malacards:  DPP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	ISS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043268	positive regulation of potassium ion transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043268	positive regulation of potassium ion transport	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function

Diseases

Associated diseases	References
Cancer	GAD: 20686608
Cancer (pancreatic)	GAD: 20686608
Familial idiopathic ventricular fibrillation	KEGG: H00730
Ventricular fibrillation	OMIM: 126141
Movement disorders	GAD: 21826085
Mental retardation	OMIM: 126141
Amyotrophic lateral sclerosis (ALS)	GAD: 18057069
Endometriosis	INFBASE: 25083881
Recurrent pregnancy loss (RPL)	INFBASE: 24937803
Azoospermia	MIK: 24937803
Male factor infertility	MIK: 24937803
Azoopsermia	MIK: 24937803
Azoospermia, Recurrent miscarriages	MIK: 24937803
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24937803	Azoospermia, Recurrent miscarriages	46, XY, inv ins(18,7) (q22.1; q36.2q21.11)		2 (1 azoospermia, 1 recurrent miscarriages)	Male infertility, Female infertility	DPP6 CACNA2D1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq