• Gene id: 1803

Gene Summary

• Gene Symbol: DPP4   Gene   UCSC   Ensembl
• Aliases: ADABP, ADCP2, CD26, DPPIV, TP103
• Gene name: dipeptidyl peptidase 4
• Alternate names: dipeptidyl peptidase 4, ADCP-2, DPP IV, Gly-Pro naphthylamidase, Post-proline dipeptidyl aminopeptidase IV, T-cell activation antigen CD26, Xaa-Pro-dipeptidylaminopeptidase, adenosine deaminase complexing protein 2, dipeptidyl peptidase IV, dipeptidylpeptidase 4, d,
• Gene location: 2q24.2 (162074214: 161992240)     Exons: 26     NC_000002.12
• Gene summary(Entrez): The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline
• OMIM: 615756

Protein Summary

• Protein general information: P27487  
  • Name: Dipeptidyl peptidase 4 (EC 3.4.14.5) (ADABP) (Adenosine deaminase complexing protein 2) (ADCP 2) (Dipeptidyl peptidase IV) (DPP IV) (T cell activation antigen CD26) (TP103) (CD antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form (Dipeptidyl
  • Length: 766  
  • Mass: 88279
  • Tissue specificity: Expressed specifically in lymphatic vessels but not in blood vessels in the skin, small intestine, esophagus, ovary, breast and prostate glands. Not detected in lymphatic vessels in the lung, kidney, uterus, liver and stomach (at prote
• Sequence:

  MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENN
  ILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPN
  NTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAY
  AQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
  CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKII
  SNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELN
  PERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFW
  YQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
  FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPT
  PEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQH
  IYTHMSHFIKQCFSLP

• Structural information:
  • Interpro: IPR029058  IPR002471  IPR001375  IPR002469  IPR038554  
  • Prosite: PS00708
  • PDB: 1J2E 1N1M 1NU6 1NU8 1PFQ 1R9M 1R9N 1RWQ 1TK3 1TKR 1U8E 1W1I 1WCY 1X70 2AJL 2BGN 2BGR 2BUB 2FJP 2G5P 2G5T 2G63 2HHA 2I03 2I78 2IIT 2IIV 2JID 2OAG 2OGZ 2OLE 2ONC 2OPH 2OQI 2OQV 2P8S 2QJR 2QKY 2QOE 2QT9 2QTB 2RGU 2RIP 3BJM 3C43 3C45 3CCB 3CCC 3D4L 3EIO 3F8S 3G0B 3G0C 3G0D 3G0G 3H0C 3HAB 3HAC 3KWF 3KWJ 3NOX 3O95 3O9V 3OC
  • PDBsum: 1J2E 1N1M 1NU6 1NU8 1PFQ 1R9M 1R9N 1RWQ 1TK3 1TKR 1U8E 1W1I 1WCY 1X70 2AJL 2BGN 2BGR 2BUB 2FJP 2G5P 2G5T 2G63 2HHA 2I03 2I78 2IIT 2IIV 2JID 2OAG 2OGZ 2OLE 2ONC 2OPH 2OQI 2OQV 2P8S 2QJR 2QKY 2QOE 2QT9 2QTB 2RGU 2RIP 3BJM 3C43 3C45 3CCB 3CCC 3D4L 3EIO 3F8S 3G0B 3G0C 3G0D 3G0G 3H0C 3HAB 3HAC 3KWF 3KWJ 3NOX 3O95 3O9V 3OC
  • DIP: 351
  • STRING: ENSP00000353731
• Other Databases: GeneCards:  DPP4  Malacards:  DPP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045499	chemorepellent activity	IDA	molecular function
GO:0045499	chemorepellent activity	IMP	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0090024	negative regulation of neutrophil chemotaxis	IMP	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0071438	invadopodium membrane	IDA	cellular component
GO:0043542	endothelial cell migration	IDA	biological process
GO:0031295	T cell costimulation	IDA	biological process
GO:0031295	T cell costimulation	IDA	biological process
GO:0010716	negative regulation of extracellular matrix disassembly	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0001666	response to hypoxia	IDA	biological process
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036343	psychomotor behavior	IEA	biological process
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0001662	behavioral fear response	IEA	biological process
GO:0046581	intercellular canaliculus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0050919	negative chemotaxis	IEA	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0042110	T cell activation	IDA	biological process
GO:0008239	dipeptidyl-peptidase activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0008236	serine-type peptidase activity	IDA	molecular function
GO:0033632	regulation of cell-cell adhesion mediated by integrin	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:19705345
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881