• Gene id: 1800

Gene Summary

• Gene Symbol: DPEP1   Gene   UCSC   Ensembl
• Aliases: MBD1, MDP, RDP
• Gene name: dipeptidase 1
• Alternate names: dipeptidase 1, beta-lactamase, dehydropeptidase-I, dipeptidase 1 (renal), hRDP, microsomal dipeptidase, renal dipeptidase, testicular tissue protein Li 57,
• Gene location: 16q24.3 (89613307: 89641539)     Exons: 17     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukot
• OMIM: 106150

Protein Summary

• Protein general information: P16444  
  • Name: Dipeptidase 1 (EC 3.4.13.19) (Beta lactamase) (EC 3.5.2.6) (Dehydropeptidase I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
  • Length: 411  
  • Mass: 45674
  • Tissue specificity: Expressed in lung and kidneys. {ECO
• Sequence:

  MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGF
  VGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSL
  GVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQ
  LSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
  FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGG
  SCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL

• Structural information:
  • Interpro: IPR000180  IPR028536  IPR032466  IPR008257  
  • Prosite: PS00869 PS51365
  • CDD: cd01301
  • PDB: 1ITQ 1ITU
  • PDBsum: 1ITQ 1ITU
  • STRING: ENSP00000376807
• Other Databases: GeneCards:  DPEP1  Malacards:  DPEP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008800	beta-lactamase activity	IDA	molecular function
GO:0016999	antibiotic metabolic process	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0006751	glutathione catabolic process	ISS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008239	dipeptidyl-peptidase activity	IEA	molecular function
GO:0008235	metalloexopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008800	beta-lactamase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008800	beta-lactamase activity	IEA	molecular function
GO:0016999	antibiotic metabolic process	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0006751	glutathione catabolic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0031528	microvillus membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0070573	metallodipeptidase activity	IDA	molecular function
GO:0072341	modified amino acid binding	IDA	molecular function
GO:0050667	homocysteine metabolic process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0070573	metallodipeptidase activity	IDA	molecular function
GO:0045177	apical part of cell	IDA	cellular component
GO:0035690	cellular response to drug	IDA	biological process
GO:0016999	antibiotic metabolic process	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034235	GPI anchor binding	ISS	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0072340	cellular lactam catabolic process	TAS	biological process
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:0008235	metalloexopeptidase activity	TAS	molecular function
GO:0006749	glutathione metabolic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0005886	plasma membrane	TAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq