• Gene id: 1797

Gene Summary

• Gene Symbol: DXO   Gene   UCSC   Ensembl
• Aliases: DOM3L, DOM3Z, NG6, RAI1
• Gene name: decapping exoribonuclease
• Alternate names: decapping and exoribonuclease protein, protein Dom3Z,
• Gene location: 6p21.33 (31972289: 31969810)     Exons: 6     NC_000006.12
• Gene summary(Entrez): This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. The function of its protein product is unknown, but its ubiquitous expression and conservation in both simple and complex eukaryotes suggests that this may
• OMIM: 605996

Protein Summary

• Protein general information: O77932  
  • Name: Decapping and exoribonuclease protein (DXO) (EC 3.1.13. ) (EC 3.6.1. ) (Dom 3 homolog Z)
  • Length: 396  
  • Mass: 44929
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPT
  NGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQ
  LAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLG
  SHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFV
  SSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLP
  IWYVEAMTQDLPSPPKTPSPK

• Structural information:
  • Interpro: IPR013961  IPR039039  
  • STRING: ENSP00000364498
• Other Databases: GeneCards:  DXO  Malacards:  DXO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034353	RNA pyrophosphohydrolase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0110155	NAD-cap decapping	IBA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000956	nuclear-transcribed mRNA catabolic process	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0110155	NAD-cap decapping	IDA	biological process
GO:0110155	NAD-cap decapping	IDA	biological process
GO:0050779	RNA destabilization	ISS	biological process
GO:0034353	RNA pyrophosphohydrolase activity	ISS	molecular function
GO:0003729	mRNA binding	ISS	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0110152	RNA NAD-cap (NAD-forming) hydrolase activity	ISS	molecular function
GO:0090305	nucleic acid phosphodiester bond hydrolysis	ISS	biological process
GO:0071028	nuclear mRNA surveillance	ISS	biological process
GO:0008409	5'-3' exonuclease activity	ISS	molecular function
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray