• Gene id: 1787

Gene Summary

• Gene Symbol: TRDMT1   Gene   UCSC   Ensembl
• Aliases: DMNT2, DNMT2, MHSAIIP, PUMET, RNMT1
• Gene name: tRNA aspartic acid methyltransferase 1
• Alternate names: tRNA (cytosine(38)-C(5))-methyltransferase, DNA (cytosine-5)-methyltransferase-like protein 2, DNA MTase homolog HsaIIP, DNA cytosine-5 methyltransferase 2, DNA methyltransferase-2, tRNA (cytosine-5-)-methyltransferase,
• Gene location: 10p13 (17202070: 17137335)     Exons: 15     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein responsible for the methylation of aspartic acid transfer RNA, specifically at the cytosine-38 residue in the anticodon loop. This enzyme also possesses residual DNA-(cytosine-C5) methyltransferase activity. While similar in se
• OMIM: 607052

Protein Summary

• Protein general information: O14717  
  • Name: tRNA (cytosine(38) C(5)) methyltransferase (EC 2.1.1.204) (DNA (cytosine 5) methyltransferase like protein 2) (Dnmt2) (DNA methyltransferase homolog HsaIIP) (DNA MTase homolog HsaIIP) (M.HsaIIP) (PuMet)
  • Length: 391  
  • Mass: 44597
  • Tissue specificity: Ubiquitous. Higher expression in testis, ovary and thymus and at much lower levels in spleen, prostate, colon, small intestine, and peripheral blood leukocytes.
• Sequence:

  MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILM
  SPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLS
  PTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGK
  DAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY
  IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGFPEKITVKQRYRLLGN
  SLNVHVVAKLIKILYE

• Structural information:
  • Protein Domains: (4..39-)
    C5-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01016"-)
  • Interpro: IPR001525  IPR031303  IPR029063  
  • Prosite: PS00095 PS51679
  • PDB: 1G55
  • PDBsum: 1G55
  • STRING: ENSP00000367030
• Other Databases: GeneCards:  TRDMT1  Malacards:  TRDMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	ISS	molecular function
GO:0036416	tRNA stabilization	ISS	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0030488	tRNA methylation	IDA	biological process
GO:0008175	tRNA methyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	EXP	molecular function
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	EXP	molecular function
GO:0006400	tRNA modification	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0001975	response to amphetamine	IEA	biological process
GO:0030488	tRNA methylation	IEA	biological process
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	IEA	molecular function
GO:0036416	tRNA stabilization	IEA	biological process
GO:0008175	tRNA methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	ISS	molecular function
GO:0036416	tRNA stabilization	ISS	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0030488	tRNA methylation	IDA	biological process
GO:0008175	tRNA methyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	EXP	molecular function
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	EXP	molecular function
GO:0006400	tRNA modification	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0001975	response to amphetamine	IEA	biological process
GO:0030488	tRNA methylation	IEA	biological process
GO:0016428	tRNA (cytosine-5-)-methyltransferase activity	IEA	molecular function
GO:0036416	tRNA stabilization	IEA	biological process
GO:0008175	tRNA methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881