• Gene id: 1783

Gene Summary

• Gene Symbol: DYNC1LI2   Gene   UCSC   Ensembl
• Aliases: DNCLI2, LIC2
• Gene name: dynein cytoplasmic 1 light intermediate chain 2
• Alternate names: cytoplasmic dynein 1 light intermediate chain 2, LIC-2, LIC53/55, dynein light intermediate chain 2, cytosolic, dynein, cytoplasmic, light intermediate polypeptide 2,
• Gene location: 16q22.1 (66751827: 66720892)     Exons: 14     NC_000016.10
• Gene summary(Entrez): Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins.[supplied by OMIM, Mar 2008]
• OMIM: 611406

Protein Summary

• Protein general information: O43237  
  • Name: Cytoplasmic dynein 1 light intermediate chain 2 (Dynein light intermediate chain 2, cytosolic) (LIC 2) (LIC53/55)
  • Length: 492  
  • Mass: 54099
• Sequence:

  MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQ
  GAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQ
  KWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGI
  PVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA
  LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPA
  TPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAG
  GVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA

• Structural information:
  • Interpro: IPR008467  IPR022780  IPR027417  
  • PDB: 6F1T 6F1Y 6F38 6F3A
  • PDBsum: 6F1T 6F1Y 6F38 6F3A
  • STRING: ENSP00000258198
• Other Databases: GeneCards:  DYNC1LI2  Malacards:  DYNC1LI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:0045504	dynein heavy chain binding	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0030286	dynein complex	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0051642	centrosome localization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04145	Phagosome
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R