• Gene id: 1781

Gene Summary

• Gene Symbol: DYNC1I2   Gene   UCSC   Ensembl
• Aliases: DIC74, DNCI2, IC2, NEDMIBA
• Gene name: dynein cytoplasmic 1 intermediate chain 2
• Alternate names: cytoplasmic dynein 1 intermediate chain 2, DH IC-2, dynein intermediate chain 2, cytosolic, dynein, cytoplasmic, intermediate polypeptide 2, testis tissue sperm-binding protein Li 66n,
• Gene location: 2q31.1 (4739927: 4733532)     Exons: 6     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the dynein intermediate chain family. The encoded protein is a non-catalytic component of the cytoplasmic dynein 1 complex, which acts as a retrograde microtubule motor to transport organelles and vesicles. A pseudogene of th
• OMIM: 603331

Protein Summary

• Protein general information: Q13409  
  • Name: Cytoplasmic dynein 1 intermediate chain 2 (Cytoplasmic dynein intermediate chain 2) (Dynein intermediate chain 2, cytosolic) (DH IC 2)
  • Length: 638  
  • Mass: 71457
• Sequence:

  MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGLTPESPI
  VFSEYWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSVLQLHSDSDLGRGPIKLGMAKITQVDFPP
  REIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSF
  FDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYN
  NNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPL
  SAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVG
  SEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNAD
  YVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVG
  EQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

• Structural information:
  • Interpro: IPR025956  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50294
  • PDB: 5JPW 6F1T 6F1U 6F1Z 6F38 6F3A
  • PDBsum: 5JPW 6F1T 6F1U 6F1Z 6F38 6F3A
  • STRING: ENSP00000380308
• Other Databases: GeneCards:  DYNC1I2  Malacards:  DYNC1I2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045503	dynein light chain binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:2000582	positive regulation of ATP-dependent microtubule motor activity, plus-end-directed	IBA	biological process
GO:0045504	dynein heavy chain binding	IBA	molecular function
GO:0010970	transport along microtubule	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0030286	dynein complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0007018	microtubule-based movement	NAS	biological process
GO:0003777	microtubule motor activity	NAS	molecular function
GO:0005737	cytoplasm	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04145	Phagosome
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)