• Gene id: 1777

Gene Summary

• Gene Symbol: DNASE2   Gene   UCSC   Ensembl
• Aliases: DNASE2A, DNL, DNL2
• Gene name: deoxyribonuclease 2, lysosomal
• Alternate names: deoxyribonuclease-2-alpha, DNase II alpha, DNase II, lysosomal, R31240_2, acid DNase, deoxyribonuclease II alpha, deoxyribonuclease II, lysosomal, lysosomal DNase II,
• Gene location: 19p13.13 (12881448: 12875208)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (l
• OMIM: 300168

Protein Summary

• Protein general information: O00115  
  • Name: Deoxyribonuclease 2 alpha (EC 3.1.22.1) (Acid DNase) (Deoxyribonuclease II alpha) (DNase II alpha) (Lysosomal DNase II) (R31240_2)
  • Length: 360  
  • Mass: 39581
• Sequence:

  MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINSPEGAV
  GRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSA
  CTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEPWNSSITLTSQAGAVF
  QSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV
  SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI

• Structural information:
  • Interpro: IPR004947  
  • STRING: ENSP00000222219
• Other Databases: GeneCards:  DNASE2  Malacards:  DNASE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004531	deoxyribonuclease II activity	IBA	molecular function
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0004531	deoxyribonuclease II activity	IEA	molecular function
GO:0006259	DNA metabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004531	deoxyribonuclease II activity	TAS	molecular function
GO:0005764	lysosome	TAS	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0006259	DNA metabolic process	TAS	biological process
GO:0004531	deoxyribonuclease II activity	IEA	molecular function
GO:0050776	regulation of immune response	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0004531	deoxyribonuclease II activity	IEA	molecular function
GO:0004520	endodeoxyribonuclease activity	IEA	molecular function
GO:0006308	DNA catabolic process	IEA	biological process
GO:0000737	DNA catabolic process, endonucleolytic	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881