• Gene id: 1750

Gene Summary

• Gene Symbol: DLX6   Gene   UCSC   Ensembl
• Gene name: distal-less homeobox 6
• Alternate names: homeobox protein DLX-6, distal-less homeo box 6,
• Gene location: 7q21.3 (97005552: 97011039)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This
• OMIM: 600030

Protein Summary

• Protein general information: P56179  
  • Name: Homeobox protein DLX 6
  • Length: 175  
  • Mass: 19708
• Sequence:

  MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLA
  LPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPP
  NSYMPGYSHWYSSPHQDTMQRPQMM

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  IPR000047  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000428480
• Other Databases: GeneCards:  DLX6  Malacards:  DLX6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0048646	anatomical structure formation involved in morphogenesis	IEA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0060322	head development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)