• Gene id: 1746

Gene Summary

• Gene Symbol: DLX2   Gene   UCSC   Ensembl
• Aliases: TES-1, TES1
• Gene name: distal-less homeobox 2
• Alternate names: homeobox protein DLX-2, distal-less homeo box 2,
• Gene location: 2q31.1 (172102899: 172099437)     Exons: 3     NC_000002.12
• Gene summary(Entrez): Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed
• OMIM: 606521

Protein Summary

• Protein general information: Q07687  
  • Name: Homeobox protein DLX 2
  • Length: 328  
  • Mass: 34243
• Sequence:

  MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAG
  GGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEPEIRIVNGKPK
  KVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGAS
  ASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLL
  HPTQTPQPHHHHHHHGGGGAPVSAGTIF

• Structural information:
  • Interpro: IPR022135  IPR009057  IPR017970  IPR001356  IPR020479   IPR000047  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000234198
• Other Databases: GeneCards:  DLX2  Malacards:  DLX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:1902871	positive regulation of amacrine cell differentiation	ISS	biological process
GO:0046533	negative regulation of photoreceptor cell differentiation	ISS	biological process
GO:0045597	positive regulation of cell differentiation	ISS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0007420	brain development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048755	branching morphogenesis of a nerve	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0021882	regulation of transcription from RNA polymerase II promoter involved in forebrain neuron fate commitment	IEA	biological process
GO:0021879	forebrain neuron differentiation	IEA	biological process
GO:0021544	subpallium development	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003727	single-stranded RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:1902871	positive regulation of amacrine cell differentiation	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0048715	negative regulation of oligodendrocyte differentiation	IEA	biological process
GO:0048706	embryonic skeletal system development	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0046533	negative regulation of photoreceptor cell differentiation	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0021893	cerebral cortex GABAergic interneuron fate commitment	IEA	biological process
GO:0021892	cerebral cortex GABAergic interneuron differentiation	IEA	biological process
GO:0021772	olfactory bulb development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray