• Gene id: 1742

Gene Summary

• Gene Symbol: DLG4   Gene   UCSC   Ensembl
• Aliases: MRD62, PSD95, SAP-90, SAP90
• Gene name: discs large MAGUK scaffold protein 4
• Alternate names: disks large homolog 4, Tax interaction protein 15, discs large homolog 4, post-synaptic density protein 95, synapse-associated protein 90,
• Gene location: 17p13.1 (7220049: 7187179)     Exons: 27     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at pos
• OMIM: 602954

Protein Summary

• Protein general information: P78352  
  • Name: Disks large homolog 4 (Postsynaptic density protein 95) (PSD 95) (Synapse associated protein 90) (SAP 90) (SAP90)
  • Length: 724  
  • Mass: 80495
  • Tissue specificity: Brain.
• Sequence:

  MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGL
  GFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMR
  RKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMH
  EDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
  LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQA
  AIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQ
  ALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYET
  VTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
  AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFD
  RATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL

• Structural information:
  • Protein Domains: (65..15-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (160..24-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (313..39-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (-)
  • Interpro: IPR016313  IPR019590  IPR008145  IPR008144  IPR020590   IPR027417  IPR001478  IPR019583  IPR036034  IPR036028  IPR001452  
  • Prosite: PS00856 PS50052 PS50106 PS50002
  • PDB: 1KEF 2MES 3I4W 3K82 3ZRT 5J7J 5JXB 6QJD 6QJF 6QJG 6QJI 6QJJ 6QJK 6QJL 6QJN 6SPV 6SPZ
  • PDBsum: 1KEF 2MES 3I4W 3K82 3ZRT 5J7J 5JXB 6QJD 6QJF 6QJG 6QJI 6QJJ 6QJK 6QJL 6QJN 6SPV 6SPZ
  • DIP: 30919
  • STRING: ENSP00000382428
• Other Databases: GeneCards:  DLG4  Malacards:  DLG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150012	positive regulation of neuron projection arborization	ISS	biological process
GO:0035865	cellular response to potassium ion	ISS	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	TAS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0031594	neuromuscular junction	IBA	cellular component
GO:0043113	receptor clustering	IBA	biological process
GO:0097113	AMPA glutamate receptor clustering	IBA	biological process
GO:0098970	postsynaptic neurotransmitter receptor diffusion trapping	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0008328	ionotropic glutamate receptor complex	IBA	colocalizes with
GO:0030054	cell junction	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0097120	receptor localization to synapse	IBA	biological process
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008076	voltage-gated potassium channel complex	ISS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007612	learning	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0019900	kinase binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:2000310	regulation of NMDA receptor activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0071944	cell periphery	IEA	cellular component
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0035176	social behavior	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016188	synaptic vesicle maturation	IEA	biological process
GO:0008328	ionotropic glutamate receptor complex	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:2000821	regulation of grooming behavior	IEA	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0097060	synaptic membrane	IEA	cellular component
GO:0071625	vocalization behavior	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0060076	excitatory synapse	IEA	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0044309	neuron spine	IEA	cellular component
GO:0044306	neuron projection terminus	IEA	cellular component
GO:0044224	juxtaparanode region of axon	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0035865	cellular response to potassium ion	IEA	biological process
GO:0035418	protein localization to synapse	IEA	biological process
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031812	P2Y1 nucleotide receptor binding	ISS	molecular function
GO:0033130	acetylcholine receptor binding	ISS	molecular function
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0097109	neuroligin family protein binding	ISS	molecular function
GO:0019903	protein phosphatase binding	ISS	molecular function
GO:0030165	PDZ domain binding	ISS	molecular function
GO:0031697	beta-1 adrenergic receptor binding	ISS	molecular function
GO:0031748	D1 dopamine receptor binding	ISS	molecular function
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0097110	scaffold protein binding	ISS	molecular function
GO:0002091	negative regulation of receptor internalization	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0008328	ionotropic glutamate receptor complex	ISS	colocalizes with
GO:0016188	synaptic vesicle maturation	ISS	biological process
GO:0030054	cell junction	ISS	cellular component
GO:0050806	positive regulation of synaptic transmission	ISS	biological process
GO:0097120	receptor localization to synapse	ISS	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0035418	protein localization to synapse	IDA	biological process
GO:0045184	establishment of protein localization	IDA	biological process
GO:0045202	synapse	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	colocalizes with
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	ISS	cellular component
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0032839	dendrite cytoplasm	ISS	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0044306	neuron projection terminus	ISS	cellular component
GO:0044309	neuron spine	ISS	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0097113	AMPA glutamate receptor clustering	ISS	biological process
GO:0097113	AMPA glutamate receptor clustering	TAS	biological process
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IDA	cellular component
GO:0030863	cortical cytoskeleton	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0150012	positive regulation of neuron projection arborization	ISS	biological process
GO:0035865	cellular response to potassium ion	ISS	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	TAS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0031594	neuromuscular junction	IBA	cellular component
GO:0043113	receptor clustering	IBA	biological process
GO:0097113	AMPA glutamate receptor clustering	IBA	biological process
GO:0098970	postsynaptic neurotransmitter receptor diffusion trapping	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0008328	ionotropic glutamate receptor complex	IBA	colocalizes with
GO:0030054	cell junction	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0097120	receptor localization to synapse	IBA	biological process
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008076	voltage-gated potassium channel complex	ISS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007612	learning	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0019900	kinase binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:2000310	regulation of NMDA receptor activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0071944	cell periphery	IEA	cellular component
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0035176	social behavior	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016188	synaptic vesicle maturation	IEA	biological process
GO:0008328	ionotropic glutamate receptor complex	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:2000821	regulation of grooming behavior	IEA	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0097060	synaptic membrane	IEA	cellular component
GO:0071625	vocalization behavior	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0060076	excitatory synapse	IEA	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0044309	neuron spine	IEA	cellular component
GO:0044306	neuron projection terminus	IEA	cellular component
GO:0044224	juxtaparanode region of axon	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0035865	cellular response to potassium ion	IEA	biological process
GO:0035418	protein localization to synapse	IEA	biological process
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031812	P2Y1 nucleotide receptor binding	ISS	molecular function
GO:0033130	acetylcholine receptor binding	ISS	molecular function
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0097109	neuroligin family protein binding	ISS	molecular function
GO:0019903	protein phosphatase binding	ISS	molecular function
GO:0030165	PDZ domain binding	ISS	molecular function
GO:0031697	beta-1 adrenergic receptor binding	ISS	molecular function
GO:0031748	D1 dopamine receptor binding	ISS	molecular function
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0097110	scaffold protein binding	ISS	molecular function
GO:0002091	negative regulation of receptor internalization	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0008328	ionotropic glutamate receptor complex	ISS	colocalizes with
GO:0016188	synaptic vesicle maturation	ISS	biological process
GO:0030054	cell junction	ISS	cellular component
GO:0050806	positive regulation of synaptic transmission	ISS	biological process
GO:0097120	receptor localization to synapse	ISS	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0035418	protein localization to synapse	IDA	biological process
GO:0045184	establishment of protein localization	IDA	biological process
GO:0045202	synapse	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	colocalizes with
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	ISS	cellular component
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0032839	dendrite cytoplasm	ISS	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0044306	neuron projection terminus	ISS	cellular component
GO:0044309	neuron spine	ISS	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0097113	AMPA glutamate receptor clustering	ISS	biological process
GO:0097113	AMPA glutamate receptor clustering	TAS	biological process
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IDA	cellular component
GO:0030863	cortical cytoskeleton	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04390	Hippo signaling pathway
hsa04724	Glutamatergic synapse
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Alzheimer's disease	PMID:24156266
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R