• Gene id: 171484

Gene Summary

• Gene Symbol: FAM9C   Gene   UCSC   Ensembl
• Aliases: TEX39C
• Gene name: family with sequence similarity 9 member C
• Alternate names: protein FAM9C, testis expressed 39C,
• Gene location: Xp22.2 (13044792: 13035616)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex prot
• OMIM: 603503

Protein Summary

• Protein general information: Q8IZT9  
  • Name: Protein FAM9C
  • Length: 166  
  • Mass: 19210
  • Tissue specificity: Expressed exclusively in testis. {ECO
• Sequence:

  MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIK
  EHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQ
  EQQKRWQQDGKGTERD

• Structural information:
  • Interpro: IPR006888  
  • STRING: ENSP00000334430
• Other Databases: GeneCards:  FAM9C  Malacards:  FAM9C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0007286	spermatid development	IBA	biological process
GO:0007283	spermatogenesis	IBA	biological process
GO:0000795	synaptonemal complex	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray