• Gene id: 171177

Gene Summary

• Gene Symbol: RHOV   Gene   UCSC   Ensembl
• Aliases: ARHV, CHP, WRCH2
• Gene name: ras homolog family member V
• Alternate names: rho-related GTP-binding protein RhoV, CDC42-like GTPase 2, GTP-binding protein-like 2, Rho GTPase-like protein ARHV, WRCH-2, WRCH1-related GTPase, Wnt-1 regulated Cdc42 homolog 2, Wnt-1 responsive Cdc42 homolog 2, ras homolog gene family, member V,
• Gene location: 15q15.1 (40874233: 40872213)     Exons: 3     NC_000015.10
• OMIM: 607606

Protein Summary

• Protein general information: Q96L33  
  • Name: Rho related GTP binding protein RhoV (CDC42 like GTPase 2) (GTP binding protein like 2) (Rho GTPase like protein ARHV) (Wnt 1 responsive Cdc42 homolog 2) (WRCH 2)
  • Length: 236  
  • Mass: 26217
  • Tissue specificity: Highly expressed in pancreas, placenta, and fetal brain. {ECO
• Sequence:

  MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVD
  GAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDD
  VNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLS
  RCRWKKFFCFV

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • STRING: ENSP00000220507
• Other Databases: GeneCards:  RHOV  Malacards:  RHOV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0032488	Cdc42 protein signal transduction	IBA	biological process
GO:0042995	cell projection	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881