• Gene id: 170850

Gene Summary

• Gene Symbol: KCNG3   Gene   UCSC   Ensembl
• Aliases: KV10.1, KV6.3
• Gene name: potassium voltage-gated channel modifier subfamily G member 3
• Alternate names: potassium voltage-gated channel subfamily G member 3, potassium channel, voltage gated modifier subfamily G, member 3, potassium voltage-gated channel, subfamily G, member 3, voltage-gated potassium channel 6.3, voltage-gated potassium channel Kv10.1, voltage-,
• Gene location: 2p21 (42493981: 42442016)     Exons: 2     NC_000002.12
• Gene summary(Entrez): Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
• OMIM: 603583

Protein Summary

• Protein general information: Q8TAE7  
  • Name: Potassium voltage gated channel subfamily G member 3 (Voltage gated potassium channel subunit Kv10.1) (Voltage gated potassium channel subunit Kv6.3)
  • Length: 436  
  • Mass: 49593
  • Tissue specificity: Expressed in the brain, liver, testis, small intestine, colon, thymus and adrenal gland (PubMed
• Sequence:

  MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILL
  YVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEARPGGAEAAPS
  RRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIE
  AICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
  KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSIPAACWWVIISMTTVG
  YGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARYSRSLSTEFLN

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003971  IPR011333   IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000304127
• Other Databases: GeneCards:  KCNG3  Malacards:  KCNG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005251	delayed rectifier potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq