• Gene id: 170689

Gene Summary

• Gene Symbol: ADAMTS15   Gene   UCSC   Ensembl
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 15
• Alternate names: A disintegrin and metalloproteinase with thrombospondin motifs 15, ADAM-TS 15, ADAM-TS15, ADAMTS-15, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15, preproprotein, metalloprotease disintegrin 15 with thrombospondi,
• Gene location: 11q24.3 (130448875: 130478214)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri
• OMIM: 604513

Protein Summary

• Protein general information: Q8TE58  
  • Name: A disintegrin and metalloproteinase with thrombospondin motifs 15 (ADAM TS 15) (ADAM TS15) (ADAMTS 15) (EC 3.4.24. )
  • Length: 950  
  • Mass: 103287
  • Tissue specificity: Expressed in fetal liver and kidney, but not in any of the adult tissues examined.
• Sequence:

  MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAFQEDFYLHLTPDAQFL
  APAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLCGGLRGAFGYRGAEYVISPLPNASAPAAQRN
  SQGAHLLQRRGVPGGPSGDPTSRCGVASGWNPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVV
  ADESMVKFHGADLEHYLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
  KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVK
  VCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHGDCLLDQPSKPISLPEDLPGASYTLSQQCEL
  AFGVGSKPCPYMQYCTKLWCTGKAKGQMVCQTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPY
  GPCSRTCGGGVQLARRQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
  VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCDGNLGSKKRFDKCGVC
  GGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDL
  VVKGSLLRYSGTGTAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSV
  LSLSNQVEQPDDRPPARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
  AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC

• Structural information:
  • Protein Domains: (218..42-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (428..51-)
    (/note="Disintegrin-)
    (516..57-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (839..89-)
    (/note="TSP-typ)
  • Interpro: IPR041645  IPR006586  IPR010294  IPR013273  IPR024079   IPR013277  IPR001590  IPR002870  IPR000884  IPR036383  
  • Prosite: PS50215 PS50092 PS00142
  • STRING: ENSP00000299164
• Other Databases: GeneCards:  ADAMTS15  Malacards:  ADAMTS15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0004175	endopeptidase activity	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881