|
Gene id |
170627 |
| Gene Summary Protein Summary Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
XAGE5 Gene UCSC Ensembl |
|
Aliases |
CT12.5, GAGED5, XAGE-5 |
|
Gene name |
X antigen family member 5 |
|
Alternate names |
X antigen family member 5, G antigen, family D, 5, cancer/testis antigen 12.5, cancer/testis antigen family 12, member 5, g antigen family D member 5, protein XAGE-5, |
|
Gene location |
Xp11.22 (52811294: 52818297) Exons: 10 NC_000023.11
|
|
Gene summary(Entrez) |
This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. The protein encoded by this gene shares a sequence similarity with other GAGE/PA
|
Protein Summary
|
| Protein general information
| Q8WWM1
Name: X antigen family member 5 (XAGE 5) (Cancer/testis antigen 12.5) (CT12.5) (G antigen family D member 5)
Length: 108 Mass: 12077
|
| Sequence |
MSWRGRRYRPRRCLRLAQLVGPMLEPSVPEPQQEEPPTESQDHTPGQKREDDQGAAEIQVPNLEADLQELSQSKT
GDECGDSPDVQGKILPKSEQFKMPEGGEGKPQL
|
| Structural information |
|
| Other Databases |
GeneCards: XAGE5 Malacards: XAGE5 |
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
| Unexplained infertility | MIK: 25753583 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 25753583 |
Unexplaine
d infertil
ity
|
|
|
46 (17 fertile
men, 29 male pa
tients)
|
Male infertility |
Microarray
|
Show abstract |
|