• Gene id: 170626

Gene Summary

• Gene Symbol: XAGE3   Gene   UCSC   Ensembl
• Aliases: CT12.3a, CT12.3b, GAGED4, PLAC6, XAGE-3, pp9012
• Gene name: X antigen family member 3
• Alternate names: X antigen family member 3, CT12.3, G antigen, family D, 4, cancer/testis antigen 12.3, cancer/testis antigen family 12, member 3a, cancer/testis antigen family 12, member 3b, g antigen family D member 4, placenta-specific 6, placenta-specific gene 6 protein, prote,
• Gene location: Xp11.22 (52868139: 52862527)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in i
• OMIM: 300740

Protein Summary

• Protein general information: Q8WTP9  
  • Name: X antigen family member 3 (XAGE 3) (Cancer/testis antigen 12.3) (CT12.3) (G antigen family D member 4) (Placenta specific gene 6 protein)
  • Length: 111  
  • Mass: 12302
• Sequence:

  MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQ
  SKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV

• Structural information:
  • Interpro: IPR031320  IPR008625  
  • STRING: ENSP00000303061
• Other Databases: GeneCards:  XAGE3  Malacards:  XAGE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq