• Gene id: 170589

Gene Summary

• Gene Symbol: GPHA2   Gene   UCSC   Ensembl
• Aliases: A2, GPA2, ZSIG51
• Gene name: glycoprotein hormone subunit alpha 2
• Alternate names: glycoprotein hormone alpha-2, cysteine knot protein, glycoprotein alpha 2, glycoprotein hormone alpha 2, putative secreted protein Zsig51, thyrostimulin subunit alpha,
• Gene location: 11q13.1 (64938130: 64934470)     Exons: 6     NC_000011.10
• Gene summary(Entrez): GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).[supplied by OMIM, Mar 2008]
• OMIM: 608531

Protein Summary

• Protein general information: Q96T91  
  • Name: Glycoprotein hormone alpha 2 (Putative secreted protein Zsig51) (Thyrostimulin subunit alpha)
  • Length: 129  
  • Mass: 14163
  • Tissue specificity: Found in a variety of tissues. {ECO
• Sequence:

  MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVA
  SGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

• Structural information:
  • Interpro: IPR006207  IPR029034  IPR000476  
  • Prosite: PS01225 PS50277
  • STRING: ENSP00000279168
• Other Databases: GeneCards:  GPHA2  Malacards:  GPHA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0051427	hormone receptor binding	IBA	molecular function
GO:0031531	thyrotropin-releasing hormone receptor binding	IBA	molecular function
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0007166	cell surface receptor signaling pathway	IMP	biological process
GO:0031531	thyrotropin-releasing hormone receptor binding	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881