• Gene id: 170506

Gene Summary

• Gene Symbol: DHX36   Gene   UCSC   Ensembl
• Aliases: DDX36, G4R1, MLEL1, RHAU
• Gene name: DEAH-box helicase 36
• Alternate names: ATP-dependent DNA/RNA helicase DHX36, ATP-dependent RNA helicase DHX36, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36, DEAD/H box polypeptide 36, DEAH (Asp-Glu-Ala-His) box polypeptide 36, DEAH box protein 36, G4 resolvase-1, MLE-like protein 1, RNA helicase as,
• Gene location: 3q25.2 (154324496: 154272545)     Exons: 25     NC_000003.12
• Gene summary(Entrez): This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. The protein encoded by this gene has been shown to enhance the deadenylation and decay of mRNAs with
• OMIM: 612767

Protein Summary

• Protein general information: Q9H2U1  
  • Name: ATP dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH box protein 36) (G4 resolvase 1) (G4R1) (MLE like protein 1) (RNA helicase associated with AU rich element protein)
  • Length: 1008  
  • Mass: 114760
  • Tissue specificity: Highly expressed in testis. {ECO
• Sequence:

  MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNK
  EAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQ
  EKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQV
  TVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRL
  PRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFS
  EYFGNCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVREL
  RRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLH
  SLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRK
  GRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRHLM
  ELNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLSFKDPFVIPLGKEKIADARRKELAK
  DTRSDHLTVVNAFEGWEEARRRGFRYEKDYCWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRNPKDPESNINS
  DNEKIIKAVICAGLYPKVAKIRLNLGKKRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLY
  DCTEVSPYCLLFFGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEKIESPHPVDWNDTKSR
  DCAVLSAIIDLIKTQEKATPRNFPPRFQDGYYS

• Structural information:
  • Protein Domains: (217..38-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (477..64-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR002464  IPR011709  IPR007502  IPR014001   IPR001650  IPR027417  
  • Prosite: PS00690 PS51192 PS51194
  • PDB: 2N16 2N21 6Q6R
  • PDBsum: 2N16 2N21 6Q6R
  • STRING: ENSP00000417078
• Other Databases: GeneCards:  DHX36  Malacards:  DHX36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002151	G-quadruplex RNA binding	IBA	molecular function
GO:0003678	DNA helicase activity	IBA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0003678	DNA helicase activity	IDA	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:1903843	cellular response to arsenite ion	IDA	biological process
GO:0034605	cellular response to heat	IDA	biological process
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0003678	DNA helicase activity	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0003678	DNA helicase activity	IDA	molecular function
GO:0002151	G-quadruplex RNA binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0051880	G-quadruplex DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0051880	G-quadruplex DNA binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0070034	telomerase RNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0044806	G-quadruplex DNA unwinding	IDA	biological process
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0051880	G-quadruplex DNA binding	IDA	molecular function
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0044806	G-quadruplex DNA unwinding	IDA	biological process
GO:0051880	G-quadruplex DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0070034	telomerase RNA binding	IDA	molecular function
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0051880	G-quadruplex DNA binding	IDA	molecular function
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:2000767	positive regulation of cytoplasmic translation	IMP	biological process
GO:1902064	regulation of transcription from RNA polymerase II promoter involved in spermatogenesis	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:1901534	positive regulation of hematopoietic progenitor cell differentiation	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0002151	G-quadruplex RNA binding	IMP	molecular function
GO:0031442	positive regulation of mRNA 3'-end processing	IMP	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:1904582	positive regulation of intracellular mRNA localization	ISS	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:0002151	G-quadruplex RNA binding	IMP	molecular function
GO:0001503	ossification	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1902741	positive regulation of interferon-alpha secretion	IMP	biological process
GO:0005524	ATP binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006359	regulation of transcription by RNA polymerase III	IMP	biological process
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IMP	biological process
GO:0051891	positive regulation of cardioblast differentiation	ISS	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045995	regulation of embryonic development	ISS	biological process
GO:1904358	positive regulation of telomere maintenance via telomere lengthening	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034644	cellular response to UV	IMP	biological process
GO:0043204	perikaryon	ISS	cellular component
GO:0070883	pre-miRNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0042826	histone deacetylase binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0004386	helicase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1904582	positive regulation of intracellular mRNA localization	IEA	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:1902064	regulation of transcription from RNA polymerase II promoter involved in spermatogenesis	IEA	biological process
GO:1901534	positive regulation of hematopoietic progenitor cell differentiation	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0070883	pre-miRNA binding	IEA	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0051891	positive regulation of cardioblast differentiation	IEA	biological process
GO:0051880	G-quadruplex DNA binding	IEA	molecular function
GO:0045995	regulation of embryonic development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044806	G-quadruplex DNA unwinding	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0070034	telomerase RNA binding	IDA	molecular function
GO:0090669	telomerase RNA stabilization	IDA	biological process
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Regulates spermatogonia differentiation	MIK: 25611385
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
25611385	Regulates spermatogonia differentiation				Male infertility