• Gene id: 170482

Gene Summary

• Gene Symbol: CLEC4C   Gene   UCSC   Ensembl
• Aliases: BDCA-2, BDCA2, CD303, CLECSF11, CLECSF7, DLEC, HECL, PRO34150
• Gene name: C-type lectin domain family 4 member C
• Alternate names: C-type lectin domain family 4 member C, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7, C-type lectin domain family 4, member,
• Gene location: 12p13.31 (36450484: 36417905)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 606677

Protein Summary

• Protein general information: Q8WTT0  
  • Name: C type lectin domain family 4 member C (Blood dendritic cell antigen 2) (BDCA 2) (C type lectin superfamily member 7) (Dendritic lectin) (CD antigen CD303)
  • Length: 213  
  • Mass: 25038
  • Tissue specificity: Expressed in plasmacytoid dendritic cells (PDCs). Constitutively expressed in immature monocyte-derived dendritic cells (iMDDC) and is significantly down-regulated upon maturation with LPS but not with TNF-alpha. {ECO
• Sequence:

  MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLREYQQYHPSLTCVMEGK
  DIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGR
  RHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

• Structural information:
  • Protein Domains: (90..20-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR033989  IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03590
  • PDB: 3WBP 3WBQ 3WBR 4ZES 4ZET
  • PDBsum: 3WBP 3WBQ 3WBR 4ZES 4ZET
  • DIP: 29513
  • STRING: ENSP00000440428
• Other Databases: GeneCards:  CLEC4C  Malacards:  CLEC4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq