• Gene id: 170392

Gene Summary

• Gene Symbol: OIT3   Gene   UCSC   Ensembl
• Aliases: LZP
• Gene name: oncoprotein induced transcript 3
• Alternate names: oncoprotein-induced transcript 3 protein, liver-specific ZP domain-containing protein, liver-specific zona pellucida domain-containing protein,
• Gene location: 10q22.1 (72893738: 72933035)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene was identified due to its downregulation in hepatocarcinomas. The encoded protein may be involved in liver development and function. [provided by RefSeq, Sep 2016]

Protein Summary

• Protein general information: Q8WWZ8  
  • Name: Oncoprotein induced transcript 3 protein (Liver specific zona pellucida domain containing protein)
  • Length: 545  
  • Mass: 60022
  • Tissue specificity: Liver-specific. Expressed only in the hepatocytes. Down-regulated in hepatocellular carcinoma (HCC) and HCC cell lines. {ECO
• Sequence:

  MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWYHFTGMAGDAMPTFCI
  PENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVEVKACPGGYYVYRLTKPSVCFHVYCGHFYDI
  CDEDCHGSCSDTSECTCAPGTVLGPDRQTCFDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVE
  GCHNNNGGCSHSCLGSEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
  THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPRLYTISEGYVPNLRNS
  PLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGIEPVVHVSGLESLVESCFATPTSKIDEVLKY
  YLIRDGCVSDDSVKQYTSRDHLAKHFQVPVFKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGED
  SAGLQGQTLTGGPIRIDWED

• Structural information:
  • Protein Domains: (182..22-)
    (/note="EGF-lik-)
    (-)
    (/evidence="ECO:0000255-)
    (261..51-)
    (/note="ZP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00375"-)
  • Interpro: IPR001881  IPR000742  IPR000152  IPR018097  IPR001507  
  • Prosite: PS00010 PS01187 PS51034
  • STRING: ENSP00000333900
• Other Databases: GeneCards:  OIT3  Malacards:  OIT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903118	urate homeostasis	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq