About Us

Search Result


Gene id 170261
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol ZCCHC12   Gene   UCSC   Ensembl
Aliases PNMA7A, SIZN, SIZN1
Gene name zinc finger CCHC-type containing 12
Alternate names zinc finger CCHC domain-containing protein 12, paraneoplastic Ma antigen family member 7A, smad-interacting zinc finger protein 1, zinc finger, CCHC domain containing 12,
Gene location Xq24 (118823823: 118826967)     Exons: 4     NC_000023.11
Gene summary(Entrez) This gene encodes a downstream effector of bone morphogenetic protein (BMP) signalling. This protein contains a zinc finger domain and functions as a transcriptional coactivator. Variation in this gene may be associated with X-linked cognitive disability.
OMIM 151510

Protein Summary

Protein general information Q6PEW1  

Name: Zinc finger CCHC domain containing protein 12 (Smad interacting zinc finger protein 1)

Length: 402  Mass: 45369

Sequence MASIIARVGNSRRLNAPLPPWAHSMLRSLGRSLGPIMASMADRNMKLFSGRVVPAQGEETFENWLTQVNGVLPDW
NMSEEEKLKRLMKTLRGPAREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGEKASLYVI
RLEVQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDA
FIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRAR
PQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLII
TLQELTHTEMERSRVAPGEYNDFSEPL
Structural information
Interpro:  IPR026523  IPR036875  
STRING:   ENSP00000308921
Other Databases GeneCards:  ZCCHC12  Malacards:  ZCCHC12

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0046872 metal ion binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:1903508 positive regulation of nu
cleic acid-templated tran
scription
IEA biological process
GO:0030509 BMP signaling pathway
IBA biological process
GO:0030374 nuclear receptor transcri
ption coactivator activit
y
IBA molecular function
GO:0016607 nuclear speck
IBA cellular component
GO:0008270 zinc ion binding
IEA molecular function
GO:0003676 nucleic acid binding
IEA molecular function
GO:0046872 metal ion binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:1903508 positive regulation of nu
cleic acid-templated tran
scription
IEA biological process
GO:0030509 BMP signaling pathway
IBA biological process
GO:0030374 nuclear receptor transcri
ption coactivator activit
y
IBA molecular function
GO:0016607 nuclear speck
IBA cellular component
GO:0008270 zinc ion binding
IEA molecular function
GO:0003676 nucleic acid binding
IEA molecular function
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract